現貨供應，歡迎訂購: : | CD100 Human Recombinant HEK | | | Catalogue Number | PRO-1640 | | Synonyms | Thesemaphorin family containing 1 Ig-like C2-type domain, 1 PSI domain and 1 Sema domai,Semaphorin-4D, A8, BB18, GR3, SEMA4D, C9orf164, CD100, SEMAJ. | | Introduction | Semaphorin-4D (CD100) is a member of the semaphorin family containing 1 Ig-like C2-type domain, 1 PSI domain and 1 Sema domain. CD100 is the cell surface receptor forPLXN1B and PLXNB2 which plays a central role in cell-cell signaling. CD100 stimulates the migration of cerebellar granule cells and of endothelial cells, regulates dendrite and axon branching and morphogenesis. In addition, CD100 has a role in the immune system; it promotes signaling via SRC and PTK2B/PYK2, which subsequently mediates activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. | | Description | CD100 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 721 amino acids (22-734). CD100 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques. | | Source | HEK293 cells. | | Physical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | | Formulation | CD100 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4. | | Solubility | It is recommended to reconstitute the lyophilized CCD100 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | | Stability | Lyophilized CD100 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD100 should be stored at 4°C between 2-7 days and for future use below -18°C.
Please prevent freeze-thaw cycles. | | Purity | Greater than 95% as determined by SDS-PAGE. | | Amino acid sequence | MAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVFAVNALNISEKQHE
VYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLNLTSFKFLG
KNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSF
VFADVIRKSPDSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFL
KARLICSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSH
GKYMQSTTVEQSHTKWVRYNGPVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSV
TPIDNRPRLIKKDVNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQD
FEPVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQ
TESPSRGLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNSEKTMYLKSSDNRVDHHHHHH. | | Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals |
Related Products ABI3 pro-1227 Recombinant Human ABI Family, Member 3 A2LD1 pro-172 Recombinant Human AIG2-Like Domain 1 A2M pro-551 Human Alpha-2 Macroglobulin Protein ACTA2 pro-1220 Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta ACTG1 pro-377 Recombinant Human Actin Gamma 1 Actin pro-517 Actin ACTL6A pro-379 Recombinant Human Actin-Like 6A ADAM10 pro-476 Recombinant Human A Disintegrin and Metalloproteinase Domain 10 ADAM12 pro-474 Recombinant Human A Disintegrin and Metalloproteinase Domain 12 S Isoform ADFP pro-405 Recombinant Human Adipose Differentiation-Related Protein Adipsin pro-1360 Recombinant Human Complement Factor D ADRM1 pro-1079 Recombinant Human Adhesion Regulating Molecule 1 AES pro-169 Recombinant Human Amino-Terminal Enhancer of Split AFP pro-406 Human Alpha Fetoprotein Ag85A pro-1076 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85A Ag85B pro-589 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B AGR2 pro-580 Recombinant Human Anterior Gradient Protein 2 Homolog AGR3 pro-242 Recombinant Human Anterior Gradient Protein 3 Homolog AHSP pro-720 Recombinant Human Alpha Hemoglobin Stabilizing Protein AIDA pro-1370 Recombinant Human Axin Interactor Dorsalization Associated AIP pro-886 Recombinant Human Aryl Hydrocarbon Receptor Interacting Protein ALK/P80 pro-455 Recombinant Human ALK-P80 Alpha Actinin pro-518 Alpha Actinin AMBP pro-407 Human Alpha-1 Microglobulin AMBP pro-957 Recombinant Human Alpha-1 Microglobulin AMELX pro-1324 Recombinant Human Amelogenin, X-Linked AMN pro-1330 Recombinant Human Amnion Associated Transmembrane Protein AMTN pro-1301 Recombinant Human Amelotin ANAPC13 pro-1037 Recombinant Human Anaphase Promoting Complex Subunit 13 Angiostatin K1-3 pro-284 Recombinant Human Angiostatin Kringles 1-3 Angiostatin K1-4 pro-604 Human Angiostatin Kringles 1-4 ANKRD1 pro-1219 Recombinant Human Ankyrin Repeat Domain 1 ANP32A pro-252 Recombinant Human Acidic Nuclear Phosphoprotein 32 Family, Member A ANXA1 pro-679 Recombinant Human Annexin A1 ANXA10 pro-1045 Recombinant Human Annexin A10 ANXA11 pro-278 Recombinant Human Annexin A11 ANXA13 pro-197 Recombinant Human Annexin A13 ANXA2 pro-777 Recombinant Human Annexin A2 ANXA3 pro-765 Recombinant Human Annexin A3 ANXA4 pro-766 Recombinant Human Annexin A4 ANXA5 pro-732 Recombinant Human Annexin A5 ANXA5 Sf9 pro-137 Recombinant Human Annexin A5, Sf9 ANXA6 pro-767 Recombinant Human Annexin A6 ANXA7 pro-449 Recombinant Human Annexin A7 ANXA8 pro-548 Recombinant Human Annexin A8 ANXA8L2 pro-1138 Recombinant Human Annexin A8 Like-2 ANXA9 pro-450 Recombinant Human Annexin A9 AP1S2 pro-234 Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2 AP2M1 pro-451 Recombinant Human Assembly Protein Complex 2 AP3S1 pro-1280 Recombinant Human Assembly Protein Complex 3 Subunit-1 AP3S2 pro-452 Recombinant Human Assembly Protein Complex 3 Subunit-2 APCS pro-453 Recombinant Human Amyloid P Component APIP pro-1186 Recombinant Human APAF1 interacting protein Apo Transferrin pro-325 Human Apo Transferrin APP pro-1080 Recombinant Human Amyloid beta (A4) Precursor Protein bApo Transferrin pro-511 Bovine Apo Transferrin bAprotinin pro-285 Bovine Aprotinin bAprotinin pro-414 Recombinant Bovine Aprotinin APTX pro-790 Recombinant Human Aprataxin ARC pro-1403 Recombinant Human Activity-Regulated Cytoskeleton-Associated Protein ARF1 pro-867 Recombinant Human ADP-Ribosylation Factor 1 ARF3 pro-933 Recombinant Human ADP-Ribosylation Factor 3 ARF4 pro-066 Recombinant Human ADP-Ribosylation Factor 4 ARF5 pro-245 Recombinant Human ADP-Ribosylation Factor 5 ARF6 pro-032 Recombinant Human ADP-Ribosylation Factor 6 ARFIP2 pro-1201 Recombinant Human ADP-Ribosylation Factor Interacting Protein 2 ARHGDIA pro-002 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha ARHGDIB pro-1067 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta ARL1 pro-508 Recombinant Human ADP-Ribosylation Factor-Like 1 ARL11 pro-884 Recombinant Human ADP-Ribosylation Factor-Like 11 ARL14 pro-936 Recombinant Human ADP-Ribosylation Factor-Like 14 ARL15 pro-956 Recombinant Human ADP-Ribosylation Factor-Like 15 ARL2 pro-074 Recombinant Human ADP-Ribosylation Factor-Like 2 ARL2BP pro-274 Recombinant Human ADP-Ribosylation Factor-Like 2 Binding Protein ARL3 pro-939 Recombinant Human ADP-Ribosylation Factor-Like 3 ARL4A pro-895 Recombinant Human ADP-Ribosylation Factor-Like 4A ARL4D pro-953 Recombinant Human ADP-Ribosylation Factor-Like 4D ARL5A pro-040 Recombinant Human ADP-Ribosylation Factor-Like 5A ARL5B pro-897 Recombinant Human ADP-Ribosylation Factor-Like 5B ARL6 pro-232 Recombinant Human ADP-Ribosylation Factor-Like 6 ARL9 pro-1009 Recombinant Human ADP-Ribosylation Factor-Like 9 ARPC2 pro-1398 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 2 ARPC5 pro-145 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 5 ARPC3 pro-1413 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 3 ASF1A pro-682 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog A ASF1B pro-1163 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B ASGR2 pro-1261 Recombinant Human Asialoglycoprotein Receptor 2 ASNA1 pro-1247 Recombinant Human arsA Arsenite Transporter, ATP-Binding, Homolog 1 ATG10 pro-1234 Recombinant Human Autophagy Related 10 ATG4B pro-1048 Recombinant Human ATG4 Autophagy Related 4 Homolog B ATG5 pro-454 Recombinant Human Autophagy Related 5 ATOH1 pro-1073 Recombinant Human Atonal Homolog 1 ATOX1 pro-754 Recombinant Human Copper Transport Protein ATOX1 ATPIF1 pro-1154 Recombinant Human ATPase Inhibitory Factor 1 ATXN3 pro-708 Recombinant Human Ataxin-3 Avidin pro-500 Avidin Avidin-Biotin pro-446 Modified Affinity Purified Avidin B2GP1 pro-388 Recombinant Human Beta 2 Glycoprotein-I B2GP1 pro-552 Human Beta 2 Glycoprotein-I B2M pro-337 Recombinant Human Beta 2 Microglobulin B2M pro-553 Human Beta 2 Microglobulin B2M His pro-859 Recombinant Human Beta 2 Microglobulin, His Tag BAALC pro-758 Recombinant Human Brain and Acute Leukemia, Cytoplasmatic BAD pro-458 Recombinant Human BAD BAG1 pro-817 Recombinant Human BCL2-Associated Athanogene 1 BAG2 pro-168 Recombinant Human BCL2-Associated Athanogene 2 BAG3 pro-760 Recombinant Human BCL2-Associated Athanogene 3 BAIAP2 pro-1022 Recombinant Human BAI1-Associated Protein 2 BASP1 pro-1355 Recombinant Human Brain Abundant Membrane Attached Signal Protein 1 BATF pro-119 Recombinant Human Basic Leucine Zipper Transcription Factor Batroxobin pro-607 Recombinant Batroxobin mBAX pro-412 Recombinant Mouse Bax mBAX GST pro-647 Recombinant Mouse Bax GST Tag bCAPN2 pro-330 Bovine Calpain-2 Catalytic Subunit BCAS2 pro-116 Recombinant Human Breast Carcinoma Amplified Sequence 2 BCDIN3D pro-1262 Recombinant Human BCDIN3D BCL10 pro-1058 Recombinant Human B-cell CLL/Lymphoma 10 Bcl-2 pro-630 Recombinant Human B-Cell Leukemia/Lymphoma 2 Bcl-2 -BH1 pro-631 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1 Bcl-2 -BH2 pro-632 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH2 Bcl-2 -BH3 pro-633 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH3 Bcl-2 -BH4 pro-411 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH4 BCL2 His pro-683 Recombinant Human B-Cell Lymphoma Protein 2 Alpha, His Tag Bcl-2 -NWGR pro-634 Recombinant Human B-Cell Leukemia/Lymphoma 2 -NWGR BCL2A1 pro-1102 Recombinant Human BCL2-Related Protein A1 BCL2L10 pro-1321 Recombinant Human BCL2 Like 10 BCL2L11 pro-1171 Recombinant Human BCL2 Like 11 BCL2L2 pro-768 Recombinant Human BCL2 Like 2 BCL6 pro-460 Recombinant Human B-cell CLL/lymphoma 6 BCL7A pro-1318 Recombinant Human B-cell CLL/lymphoma 7A Bcl-XL pro-639 Recombinant Human B-Cell Leukemia/Lymphoma XL Bcl-XL GST pro-640 Recombinant Human B-Cell Leukemia/Lymphoma XL GST Tag Bcl-XL His pro-641 Recombinant Human B-Cell Leukemia/Lymphoma His Tag mBcl-XL pro-1362 Recombinant Mouse B-Cell Leukemia/Lymphoma XL bECGS pro-603 Bovine Endothelial Mitogen BECN1 pro-1289 Recombinant Human Beclin 1, Autophagy Related BGN pro-1382 Recombinant Human Biglycan bFibronectin pro-059 Bovine Fibronectin bHolo Transferrin pro-510 Bovine Holo Transferrin BID pro-627 Recombinant Human BH3 Interacting Domain Death Agonist mBID pro-642 Recombinant Mouse BH3 Interacting Domain Death Agonist mBID GST pro-643 Recombinant Mouse BH3 Interacting Domain Death Agonist GST mtBID pro-644 Recombinant Mouse BH3 Interacting Domain Death Agonist p15 BIN1 pro-546 Recombinant Human Bridging Integrator 1 BIRC5 pro-613 Recombinant Human Baculoviral IAP Repeat-Containing 5 BIRC7 pro-612 Recombinant Human Baculoviral IAP Repeat-Containing 7 BIRC7 (1-280) pro-1042 Recombinant Human Baculoviral IAP Repeat-Containing 7 (1-280 a.a.) Bivalirudin pro-357 Human Bivalirudin BLNK pro-102 Recombinant Human B-Cell Linker BLOC1S2 pro-1094 Recombinant Human Biogenesis of Lysosomal Organelles Complex-1, Subunit 2 BMF pro-700 Recombinant Human Bcl2 Modifying Factor, Isoform 3 bNEFM pro-523 Bovine Neurofilament Medium Polypeptide BOLA1 pro-302 Recombinant Human BolA Homolog 1 BP-1 pro-463 Recombinant Human BP-1 BPI pro-129 Human Bactericidal/Permeability-Increasing Protein BPIFA1 pro-404 Recombinant Human BPI fold containing family A Member 1 BSA pro-422 Bovine Serum Albumin bSNRPD pro-998 Bovine Small Nuclear Ribonucleoprotein Polypeptide BTF3 pro-1333 Recombinant Human Basic Transcription Factor 3 BUB3 pro-023 Recombinant Human BUB3 bThrombin pro-447 Bovine Thrombin bTROVE2 pro-111 Bovine TROVE Domain Family, Member 2 bTrypsin pro-313 Recombinant Bovine Trypsin bVimentin pro-525 Bovine Vimentin C7ORF49 pro-1415 Recombinant Human Chromosome 7 Open Reading Frame 49 C12ORF5 pro-051 Recombinant Human Chromosome 12 Open Reading Frame 5 C14ORF129 pro-193 Recombinant Human Chromosome 14 Open Reading Frame 129 C16ORF53 pro-225 Recombinant Human Chromosome 16 Open Reading Frame 53 C17ORF49 pro-1192 Recombinant Human Chromosome 17 Open Reading Frame 49 C1q pro-554 Human Complement Component C1q C1QBP pro-636 Recombinant Human Complement Component 1 C1QTNF1 pro-654 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1 C1QTNF2 pro-133 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 2 C1QTNF3 pro-653 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3 C1QTNF6 pro-655 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6 C1QTNF7 pro-514 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7 C1QTNF8 pro-134 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 8 C1QTNF9 pro-135 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 9 C20ORF20 pro-1000 Recombinant Human Chromosome 20 Open Reading Frame 20 C3c pro-555 Human Complement Component C3c C4BPB pro-1174 Recombinant Human Complement Component 4 Binding Protein, Beta C4c pro-556 Human Complement Component C4c mC5a pro-085 Recombinant Mouse Complement Component C5a C6ORF108 pro-249 Recombinant Human Chromosome 6 Open Reading Frame 108 C8G pro-947 Recombinant Human Complement Component 8, Gamma C9ORF103 pro-1025 Recombinant Human Chromosome 9 Open Reading Frame 103 C9ORF95 pro-1116 Recombinant Human Chromosome 9 Open Reading Frame 95 CAB39 pro-857 Recombinant Human Calcium Binding Protein 39 CAB39L pro-020 Recombinant Human Calcium Binding Protein 39 Like CABP7 pro-211 Recombinant Human Calcium Binding Protein 7 CACYBP pro-831 Recombinant Human Calcyclin Binding Protein Cadherin-E pro-461 Recombinant Human Cadherin-E CALB1 pro-721 Recombinant Human Calbindin-1 CALB2 pro-401 Recombinant Human Calbindin-2 mCALB2 pro-290 Recombinant Mouse Calbindin-2 CALM2 pro-618 Recombinant Human Calmodulin-2 CALM2 135 a.a. pro-370 Recombinant Human Calmodulin-2 135 a.a. CALML3 pro-1323 Recombinant Human Calmodulin Like 3 CALN1 pro-279 Recombinant Human Calnueron-1 CALR pro-813 Recombinant Human Calreticulin Calumenin pro-696 Recombinant Human Calumenin CAMP pro-1405 Recombinant Human Cathelicidin Antimicrobial Peptide CANT1 pro-1010 Recombinant Human Calcium Activated Nucleotidase 1 CANX pro-725 Recombinant Human Calnexin CAPG pro-759 Recombinant Human Capping Protein Gelsolin-Like CAPN1 pro-363 Human Calpain-1 Catalytic Subunit CAPS pro-117 Recombinant Human Calcyphosine CAPSL pro-185 Recombinant Human Calcyphosine-Like CARD18 pro-1061 Recombinant Human Caspase Recruitment Domain Family, Member 18 Cardiac Actin pro-519 Cardiac Actin CARHSP1 pro-257 Recombinant Human Calcium Regulated Heat Stable Protein 1 CASQ2 pro-799 Recombinant Human Calsequestrin CBFB pro-534 Recombinant Human Core Binding Factor Beta CBX1 pro-876 Recombinant Human Chromobox Homolog 1 CBX3 pro-1057 Recombinant Human Chromobox Homolog 3 CBX5 pro-1062 Recombinant Human Chromobox Homolog 5 CCDC43 pro-1398 Recombinant Human Coiled-Coil Domain Containing 43 CCDC101 pro-1063 Recombinant Human Coiled-Coil Domain Containing 101 CCND2 pro-1012 Recombinant Human Cyclin D2 CCNG1 pro-1005 Recombinant Human Cyclin G1 CCS pro-251 Recombinant Human Copper Chaperone for Superoxide Dismutase CD11b pro-472 Recombinant Human CD11b CD14-CHO pro-536 Recombinant Human CD14 CHO derived mCD14 pro-537 Recombinant Mouse CD14 CD1B pro-1267 Recombinant Human CD1B CD2 pro-1337 Recombinant Human CD2 CD2 GST pro-468 Recombinant Human CD2, GST Tag CD23 pro-470 Recombinant Human CD23 CD226 pro-1353 Recombinant Human CD226 CD244 pro-1173 Recombinant Human CD244 CD247 pro-1335 Recombinant Human CD247 CD27 pro-1213 Recombinant Human CD27 CD274 pro-1103 Recombinant Human CD274 mCD274 pro-1164 Recombinant Mouse CD274 CD300C pro-273 Recombinant Human CD300C CD30 pro-1369 Recombinant Human CD30 CD3G pro-1392 Recombinant Human CD3 Gamma CD34 GST pro-292 Recombinant Human CD34 GST Tag CD34 pro-1363 Recombinant Human CD34 CD3e pro-1317 Recombinant Human CD3e CD45 pro-482 Recombinant Human CD45 CD46 pro-1414 Recombinant Human CD46 CD56 pro-483 Recombinant Human CD56 CD68 pro-1209 Recombinant Human CD68 CD68, 38 kda pro-293 Recombinant Human CD68, 38kda CD72 pro-486 Recombinant Human CD72 CD79B pro-1304 Recombinant Human CD79B CD83 pro-019 Recombinant Human CD83 CD84 pro-1229 Recombinant Human CD84 CD95 His pro-594 Recombinant Human CD95, His Tag CD99 pro-294 Recombinant Human CD99 CDC26 pro-241 Recombinant Human Cell Division Cycle 26 CDC37 pro-464 Recombinant Human Cell Division Cycle 37 CDC37, His pro-140 Recombinant Human Cell Division Cycle 37, His Tag CDC42 pro-727 Recombinant Human Cell Division Cycle 42 CDCA8 pro-222 Recombinant Human Cell Division Cycle Associated 8 CDH11 pro-1368 Recombinant Human Cadherin 11 CEA pro-287 Recombinant Human Carcinoembryonic Antigen CEBP-a pro-433 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Alpha CEBP-g pro-434 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Gamma CENPA pro-389 Recombinant Human Centromere Protein-A CENPB pro-390 Recombinant Human Centromere Protein-B CENPH pro-966 Recombinant Human Centromere Protein-H CETN1 pro-1104 Recombinant Human Centrin-1 CETN2 pro-060 Recombinant Human Centrin-2 CETN3 pro-533 Recombinant Human Centrin-3 CFL1 pro-591 Recombinant Human Cofilin-1 CFL2 pro-912 Recombinant Human Cofilin-2 CFLAR pro-920 Recombinant Human CASP8 and FADD-Like Apoptosis Regulator CHD4 pro-112 Recombinant Human Chromodomain Helicase DNA Binding Protein 4 CHGA pro-692 Recombinant Human Chromogranin A CHGA GST pro-491 Recombinant Human Chromogranin A GST Tag CHGA His pro-699 Recombinant Human Chromogranin A His Tag CHGB pro-824 Recombinant Human Chromogranin B CHMP1A pro-1308 Recombinant Human Chromatin Modifying Protein 1A CHMP1B pro-1117 Recombinant Human Charged Multivesicular Body Protein 1B CHMP2A pro-503 Recombinant Human Chromatin Modifying Protein 2A CHMP2B pro-877 Recombinant Human Chromatin Modifying Protein 2B CHMP4A pro-1024 Recombinant Human Chromatin Modifying Protein 4A CHMP5 pro-1232 Recombinant Human Charged Multivesicular Body Protein 5 CHMP6 pro-1085 Recombinant Human Charged Multivesicular Body Protein 6 CHP1 pro-847 Recombinant Human Calcium Binding Protein P22 CHRAC1 pro-1391 Recombinant Human Chromatin Accessibility Complex 1 CIAO1 pro-1396 Recombinant Human Cytosolic Iron-Sulfur Protein Assembly 1 CIAPIN1 pro-024 Recombinant Human Cytokine Induced Apoptosis Inhibitor 1 CIRBP pro-746 Recombinant Human Cold Inducible RNA Binding Protein CISD1 pro-1221 Recombinant Human CDGSH Iron Sulfur Domain 1 CITED2 pro-701 Recombinant Human Cbp/p300-Interacting Transactivator 2 CLDN4 pro-203 Recombinant Human Claudin-4 CLEC2B pro-526 Recombinant Human C-type Lectin Domain Family 2, Member B CLIC1 pro-833 Recombinant Human Chloride Intracellular Channel 1 CLIC2 pro-198 Recombinant Human Chloride Intracellular Channel 2 CLIC4 pro-173 Recombinant Human Chloride Intracellular Channel 4 CLNS1A pro-1277 Recombinant Human Chloride Channel, Nucleotide-Sensitive, 1A CLTA pro-1144 Recombinant Human Clathrin, Light Chain A CLTB pro-1172 Recombinant Human Clathrin, Light Chain B CNBP pro-1371 Recombinant Human Cellular Nucleic Acid Binding Protein CNN1 pro-1129 Recombinant Human Calponin 1, Basic, Smooth Muscle CNPY3 pro-1386 Recombinant Human Canopy 3 Homolog mCNOT7 pro-908 Recombinant Mouse CCR4-NOT Transcription Complex, Subunit 7 CNRIP1 pro-1214 Recombinant Human Cannabinoid Receptor Interacting Protein 1 COL4A3 pro-387 Recombinant Human Collagen Type IV Alpha 3 COL4A3BP pro-837 Recombinant Human Collagen Type IV Alpha 3 Binding Protein Collagen pro-359 Recombinant Human Like Collagen Collagen-3 pro-480 Recombinant Human Collagen-3 COMMD1 pro-862 Recombinant Human Copper Metabolism Domain Containing 1 COMMD9 pro-1244 Recombinant Human COMM Domain Containing 9 COMP HEK pro-132 Recombinant Human Cartilage Oligomeric Matrix Protein, HEK COPS8 pro-983 Recombinant Human COP9 Constitutive Photomorphogenic 8 COPZ1 pro-221 Recombinant Human Coatomer Protein Complex, Subunit Zeta 1 COTL1 pro-064 Recombinant Human Coactosin-Like 1 COX4NB pro-917 Recombinant Human COX4NB COX5A pro-1331 Recombinant Human Cytochrome C Oxidase Subunit Va CPLX1 pro-645 Recombinant Human Complexin-1 CPSF4 pro-1406 Recombinant Human Cleavage And Polyadenylation Specific Factor 4 CRABP1 pro-710 Recombinant Human Cellular Retinoic Acid Binding Protein 1 CRABP2 pro-637 Recombinant Human Cellular Retinoic Acid binding Protein 2 CRADD pro-465 Recombinant Human Caspase and RIP Adapter with Death Domain CRCP pro-919 Recombinant Human CGRP Receptor Component CREG1 pro-1196 Recombinant Human Cellular Repressor of E1A-Stimulated Genes 1 CRIPT pro-1105 Recombinant Human Cysteine-Rich PDZ-Binding Protein CRISP1 pro-473 Recombinant Human Cysteine-Rich Secretory Protein 1 CRK pro-275 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene CRKL pro-063 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like CRMP-1 pro-493 Recombinant Human Collapsin Response Mediator Protein-1 CRNN pro-797 Recombinant Human Cornulin CRP pro-335 Recombinant Human C-Reactive Protein CRP pro-557 Human C-Reactive Protein CRP (19-224 a.a.) pro-914 Recombinant Human C-Reactive Protein (19-224 a.a.) CRYGC pro-1095 Recombinant Human Crystallin, Gamma C CRYGD pro-913 Recombinant Human Crystallin, Gamma D CRYGN pro-1152 Recombinant Human Crystallin, Gamma N CRYGS pro-963 Recombinant Human Crystallin, Gamma S CSN2 pro-1047 Recombinant Human Casein Beta CSRP2 pro-1096 Recombinant Human Cysteine and Glycine-rich Protein 2 CST1 pro-1006 Recombinant Human Cystatin SN CST3 pro-656 Recombinant Human Cystatin C CST3 pro-413 Human Cystatin C mCST3 pro-597 Recombinant Mouse Cystatin-C rCST3 pro-438 Recombinant Rat Cystatin C CST3 Active pro-961 Recombinant Human Cystatin C Active CST4 pro-1097 Recombinant Human Cystatin 4 CST6 pro-892 Recombinant Human Cystatin E/M CST9 pro-955 Recombinant Human Cystatin 9 CSTA pro-086 Recombinant Human Cystatin-A CSTA GST pro-543 Recombinant Human Cystatin-A, GST tag CSTA His pro-504 Recombinant Human Cystatin-A His Tag CSTB pro-609 Recombinant Human Cystatin-B CSTF1 pro-1170 Recombinant Human Cleavage Stimulation Factor 1 CTBP1 pro-796 Recombinant Human C-Terminal Binding Protein 1 CTNNBIP1 pro-850 Recombinant Human Catenin, Beta Interacting Protein 1 CUL1 pro-268 Recombinant Human Cullin-1 CUTA pro-812 Recombinant Human CutA Divalent Cation Tolerance Homolog CUTC pro-911 Recombinant Human cutC Copper Transporter Homolog CYB5A pro-910 Recombinant Human Cytochrome B5 Type A CYB5R3 pro-1026 Recombinant Human Cytochrome B5 Reductase 3 Cyclosporin-A pro-408 Cyclosporin-A CYGB pro-842 Recombinant Human Cytoglobin Cys-Protein-G His pro-1238 Recombinant Cys-Protein G His Tag CYTH2 pro-1248 Recombinant Human Cytohesin 2 D4GDI pro-296 Recombinant Human D4-GDI DBI pro-832 Recombinant Human Diazepam Binding Inhibitor DBNDD1 pro-1162 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 1 DBNDD2 pro-1167 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 2 DCAF7 pro-909 Recombinant Human DDB1 and CUL4 Associated Factor 7 dCASQ2 pro-410 Dog Calsequestrin-2 DCUN1D1 pro-078 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 1 DCUN1D2 pro-899 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 2 DDIT3 pro-638 Recombinant Human DNA Damage Inducible Transcript 3 DDIT4 pro-094 Recombinant Human DNA Damage Inducible Transcript 4 DEDD pro-1349 Recombinant Human Death Effector Domain Containing DENR pro-926 Recombinant Human Density-Regulated Protein Desmin pro-520 Recombinant Human Desmin DFFA pro-718 Recombinant Human DNA Fragmentation Factor Subunit Alpha DGCR6 pro-1372 Recombinant Human DiGeorge Syndrome Critical Region Gene 6 DIRAS1 pro-256 Recombinant Human DIRAS family, GTP-binding RAS-like 1 DKK1 pro-673 Recombinant Human Dickkopf-Related Protein 1 DKK1 HEK pro-815 Recombinant Human Dickkopf-Related Protein 1 HEK DKK2 pro-1205 Recombinant Human Dickkopf-Related Protein 2 DKK3 pro-1175 Recombinant Human Dickkopf-Related Protein 3 DNAL1 pro-1357 Recombinant Human Dynein Axonemal Light Chain 1 DNAL4 pro-227 Recombinant Human Dynein Axonemal Light Chain 4 DPPA3 pro-1291 Recombinant Human Developmental Pluripotency Associated 3 DR1 pro-542 Recombinant Human Down-Regulator of Transcription 1 DRG1 pro-885 Recombinant Human Developmentally Regulated GTP Binding Protein 1 DSTN pro-1137 Recombinant Human Destrin DTNBP1 pro-675 Recombinant Human Dystrobrevin-Binding Protein 1 Isoform C DYNLL1 pro-262 Recombinant Human Dynein Light Chain LC8 Type-1 DYNLL2 pro-235 Recombinant Human Dynein Light Chain LC8 Type-2 DYNLRB1 pro-489 Recombinant Human Dynein Light Chain Roadblock-Type 1 DYNLRB2 pro-174 Recombinant Human Dynein Light Chain Roadblock-Type 2 DYNLT1 pro-757 Recombinant Human Dynein, Light Chain, Tctex-Type 1 DYNLT3 pro-1197 Recombinant Human Dynein, Light Chain, Tctex-Type 3 EBAG9 pro-343 Recombinant Human Estrogen Receptor Binding Site Associated Antigen 9 ECSIT pro-1241 Recombinant Human ECSIT homolog EDF1 pro-494 Recombinant Human Endothelial Differentiation-Related Factor 1 EEF1B2 pro-167 Recombinant Human Eukaryotic Translation Elongation Factor 1 Beta 2 EEF1D pro-170 Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta EEF1E1 pro-199 Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon 1 EFNA1 pro-971 Recombinant Human Ephrin A1 EFNA4 pro-498 Recombinant Human Ephrin A4 EFNB1 pro-918 Recombinant Human Ephrin- B1 EFNB2 pro-937 Recombinant Human Ephrin- B2 EFNB3 pro-1169 Recombinant Human Ephrin- B3 EGLN3 pro-1143 Recombinant Human Egl Nine Homolog 3 EIF1 pro-773 Recombinant Human Eukaryotic Translation Initiation Factor 1 EIF1AX pro-253 Recombinant Human Eukaryotic Translation Initiation Factor 1A X-linked EIF1AY pro-098 Recombinant Human Eukaryotic Translation Initiation Factor 1A Y-linked EIF1B pro-175 Recombinant Human Eukaryotic Translation Initiation Factor 1B EIF2B1 pro-209 Recombinant Human Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha EIF2S1 pro-845 Recombinant Human Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha EIF3J pro-970 Recombinant Human Eukaryotic Translation Initiation Factor 3J EIF3K pro-179 Recombinant Human Eukaryotic Translation Initiation Factor 3K EIF4A3 pro-1007 Recombinant Human Eukaryotic Translation Initiation Factor 4A3 EIF4E pro-530 Recombinant Human Eukaryotic Translation Initiation Factor 4E EIF4EBP1 pro-532 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 1 EIF4EBP2 pro-176 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 EIF4H pro-1114 Recombinant Human Eukaryotic Translation Initiation Factor 4H EIF5A pro-674 Recombinant Human Eukaryotic Translation Initiation Factor 5A EIF5A2 pro-846 Recombinant Human Eukaryotic Translation Initiation Factor 5A2 Eledoisin pro-281 Eledoisin EMCN pro-1156 Recombinant Human Endomucin EMG1 pro-1122 Recombinant Human EMG1 Nucleolar Protein Endostatin pro-248 Recombinant Human Endostatin Enfuvirtide pro-376 Enfuvirtide T-20 ENSA pro-772 Recombinant Human Endosulfine Alpha EPCAM pro-1322 Recombinant Human Epithelial Cell Adhesion Molecule Eptifibatide pro-358 Human Eptifibatide ER-a pro-499 Recombinant Human Estrogen Receptor Alpha ERCC1 pro-1106 Recombinant Human Excision Repair Cross-Complementing 1 ERCC1, GST pro-496 Recombinant Human Excision Repair Cross-Complementing 1, GST Tag ERH pro-121 Recombinant Human Enhancer of Rudimentary ERLIN2 pro-1266 Recombinant Human ER Lipid Raft Associated 2 ERP27 pro-046 Recombinant Human Endoplasmic Reticulum Protein 27 ERP44 pro-547 Recombinant Human Endoplasmic Reticulum Protein 44 ESAT6 pro-291 Recombinant Early Secretory Target Mycobacterium Tuberculosis E-Selectin pro-380 Recombinant Human E-Selectin ESM1 pro-1328 Recombinant Human Endothelial Cell-Specific Molecule 1 ETFB pro-220 Recombinant Human Electron-Transfer-Flavoprotein Beta Polypeptide ETHE1 pro-1027 Recombinant Human Ethylmalonic Encephalopathy 1 ETS1 pro-501 Recombinant Human C-ets-1 Protein EXOSC10 pro-444 Recombinant Human Exosome Component 10 EXOSC5 pro-1059 Recombinant Human Exosome Component 5 EXOSC9 pro-126 Recombinant Human Exosome Component 9 EYA2 pro-1071 Recombinant Human Eyes Absent Homolog 2 F11R pro-1112 Recombinant Human F11 Receptor F3 pro-312 Recombinant Human Coagulation Factor III F7 pro-331 Recombinant Human Coagulation Factor VIIa F8 pro-317 Human Coagulation Factor VIII F8 pro-318 Recombinant Human Coagulation Factor VIII F9 pro-353 Human Coagulation Factor IX FABP1 pro-588 Recombinant Human Fatty Acid Binding Protein-1 mFABP1 pro-1121 Recombinant Mouse Fatty Acid Binding Protein-1 FABP12 pro-738 Recombinant Human Fatty Acid Binding Protein-12 FABP2 pro-669 Recombinant Human Fatty Acid Binding Protein-2 FABP3 pro-340 Recombinant Human Fatty Acid Binding Protein-3 FABP3 His pro-668 Recombinant Human Fatty Acid Binding Protein-3, His Tag FABP4 pro-416 Recombinant Human Fatty Acid Binding Protein-4 FABP4 His pro-566 Recombinant Human Fatty Acid Binding Protein-4, His Tag FABP5 pro-417 Recombinant Human Fatty Acid Binding Protein-5 FABP5 His pro-666 Recombinant Human Fatty Acid Binding Protein-5, His Tag FABP6 pro-649 Recombinant Human Fatty Acid Binding Protein-6 FABP6 His pro-667 Recombinant Human Fatty Acid Binding Protein-6, His Tag FABP7 pro-628 Recombinant Human Fatty Acid Binding Protein-7 FABP7 His pro-661 Recombinant Human Fatty Acid Binding Protein-7, His Tag FABP9 pro-1088 Recombinant Human Fatty Acid Binding Protein-9 FADD pro-733 Recombinant Human Fas-Associated Death Domain FAM3B pro-139 Recombinant Human Family with Sequence Similarity 3, Member B FAM3C pro-952 Recombinant Human Family with Sequence Similarity 3, Member C FAM49B pro-1411 Recombinant Human Family with Sequence Similarity 49, Member B FCGR1A pro-1228 Recombinant Human CD64 FCGR2A pro-029 Recombinant Human CD32a FCGR2B pro-1295 Recombinant Human CD32 FCGR3A pro-1150 Recombinant Human CD16a FDCSP pro-1339 Recombinant Human Follicular Dendritic Cell Secreted Protein FDX1 pro-713 Recombinant Human Ferredoxin-1 Ferritin pro-564 Human Liver Ferritin Ferritin Heavy pro-658 Recombinant Human Ferritin Heavy Chain Ferritin Light pro-650 Recombinant Human Ferritin Light Chain Fetuin-A pro-418 Human Alpha-2-HS-Glycoprotein FHIT pro-828 Recombinant Human Fragile Histidine Triad FHIT, GST pro-297 Recombinant Human Fragile Histidine Triad, GST Tag Fibronectin pro-448 Human Fibronectin Filamin pro-521 Filamin FIMC pro-120 Recombinant E.Coli Chaperone Protein fimC FIS1 pro-829 Recombinant Human Fission-1 Flagellin pro-1240 Recombinant Flagellin FOPNL pro-1195 Recombinant Human FGFR1OP N-terminal like FOS-B pro-505 Recombinant Human FOS-B Frataxin pro-761 Recombinant Human Frataxin FRZB pro-1345 Recombinant Human Frizzled-Related Protein FSCN1 pro-527 Recombinant Human Fascin FTSJ2 pro-1207 Recombinant Human FtsJ RNA Methyltransferase Homolog 2 FUBP1 pro-1132 Recombinant Human Far Upstream Element Binding Protein FUR pro-622 Recombinant E.Coli Ferric Uptake Regulator FXYD5 pro-1366 Recombinant Human FXYD5 Fyn-p59 pro-506 Recombinant Human Fyn-p59 FZD1 pro-816 Recombinant Human Frizzled-1 GABARAP pro-775 Recombinant Human GABA(A) Receptor-Associated Protein GABARAPL1 pro-048 Recombinant Human GABA(A) Receptor-Associated Protein Like 1 GABARAPL2 pro-079 Recombinant Human GABA(A) Receptor-Associated Protein Like 2 GADD45A pro-783 Recombinant Human Growth Arrest and DNA-Damage-Inducible Alpha GADD45B pro-563 Recombinant Human Growth Arrest and DNA-Damage-Inducible Beta GADD45G pro-570 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma GADD45GIP1 pro-972 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma Interacting Protein 1 GAGA-POZ pro-435 Recombinant Drosophila melanogaster GAGA-POZ GAP43 pro-1126 Recombinant Human Growth Associated Protein 43 GAS7 pro-680 Recombinant Human Growth Arrest-Specific 7, Isoform b GCA pro-080 Recombinant Human Grancalcin GCSAM pro-1282 Recombinant Human Germinal Center-Associated, Signaling and Motility GCSH pro-973 Recombinant Human Glycine Cleavage System Protein H GCV syn-001 Ganciclovir Gelatin pro-481 Recombinant Human Gelatin GEMIN6 pro-1394 Recombinant Human Gem-Associated Protein 6 GFER pro-1326 Recombinant Human Growth Factor, Augmenter of Liver Regeneration GFP pro-522 Glial Filament Protein GINS4 pro-1270 Recombinant Human GINS Complex Subunit 4 GIPC1 pro-855 Recombinant Human GIPC PDZ Domain Member 1 GIPC2 pro-1035 Recombinant Human GIPC PDZ Domain Member 2 GKN1 pro-1206 Recombinant Human Gastrokine 1 GLC8 pro-540 Recombinant Yeast GLC8 Gliadin pro-114 Recombinant Wheat Gliadin GLIPR2 pro-550 Recombinant Human GLI Pathogenesis-Related 2 GLOD4 pro-894 Recombinant Human Glyoxalase Domain Containing 4 GLTP pro-1313 Recombinant Human Glycolipid Transfer Protein GMNN pro-579 Recombinant Human Geminin GNAI1 pro-940 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 1 GNAI2 pro-1310 Recombinant Human Guanine Nucleotide Binding Protein-G Alpha Inhibiting Activity Polypeptide 2 GNAI3 pro-1074 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 3 GNAZ pro-1225 Recombinant Human Guanine Nucleotide Binding Protein Alpha Z Polypeptide GNB2L1 pro-1023 Recombinant Human Guanine Nucleotide Binding Protein beta polypeptide 2-like 1 GNLY pro-852 Recombinant Human Granulysin GOPC pro-793 Recombinant Human Golgi-Associated PDZ and Coiled-Coil Motif Containing GOSR2 pro-1399 Recombinant Human Golgi SNAP Receptor Complex Member 2 GP2 pro-115 Recombinant Human Glycoprotein-2 GP9 pro-055 Recombinant Human Glycoprotein-9 GPN1 pro-1140 Recombinant Human GPN-loop GTPase 1 GRAP2 pro-081 Recombinant Human GRB2-Related Adaptor Protein 2 GRB2 pro-678 Recombinant Human Growth Factor Receptor-Bound Protein 2 GREM1 pro-1359 Recombinant Human GREM1 GRPEL1 pro-263 Recombinant Human GrpE-Like 1 GTF2B pro-762 Recombinant Human General Transcription Factor IIB GTF2E2 pro-1107 Recombinant Human General Transcription Factor IIE, Polypeptide 2 GTF2F2 pro-1093 Recombinant Human General Transcription Factor IIF, Polypeptide 2 GULP1 pro-1398 Recombinant Human GULP1 HAND1 pro-1231 Recombinant Human Heart and Neural Crest Derivatives Expressed 1 Haptoglobin pro-567 Recombinant Human Haptoglobin Haptoglobin pro-558 Human Haptoglobin HAUS1 pro-1077 Recombinant Human HAUS Augmin-Like Complex, Subunit 1 HAX1 pro-1367 Recombinant Human HCLS1 Associated Protein X-1 HbA1c pro-299 Human Hemoglobin A1c HBA2 pro-1183 Recombinant Human Hemoglobin, Alpha 2 HBG2 pro-021 Recombinant Human Hemoglobin Gamma G HBZ pro-803 Recombinant Human Hemoglobin-Zeta HDL pro-559 Human High Density Lipoprotein HEBP1 pro-1316 Recombinant Human Heme Binding Protein 1 Hemopexin pro-560 Human Hemopexin HES7 pro-1306 Recombinant Human Hairy and Enhancer of Split 7 HEXIM1 pro-789 Recombinant Human Hexamethylene Bis-Acetamide Inducible 1 HFE pro-1332 Recombinant Human Hemochromatosis HIF1A pro-477 Recombinant Human Hypoxia-Inducible Factor-1 Alpha HIF1A (85 a.a.) pro-258 Recombinant Human Hypoxia-Inducible Factor-1 Alpha (85 a.a.) HIF1A His pro-415 Recombinant Human Hypoxia-Inducible Factor-1 Alpha His Tag HIF1AN pro-662 Recombinant Human Hypoxia-Inducible Factor-1 Alpha Inhibitor HINT1 pro-702 Recombinant Human Histidine Triad Nucleotide Binding Protein 1 Hirudin pro-362 Recombinant Hirudin HLF pro-904 Recombinant Human Hepatic Leukemia Factor HMGA1 pro-887 Recombinant Human High Mobility Group AT-Hook 1 HMGB1 pro-581 Recombinant Human High-Mobility Group Box 1 HMGB1 Hi-5 pro-610 Recombinant Human High-Mobility Group Box 1 Hi-5 Insect Cells HMGB2 pro-888 Recombinant Human High-Mobility Group Box 2 HMGN1 pro-821 Recombinant Human High-Mobility Group Nucleosome Binding Domain 1 HN1L pro-027 Recombinant Human Hematological and Neurological Expressed 1-Like HNRNPA1 pro-1038 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein A1 HNRNPC pro-177 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C Holo Transferrin pro-315 Human Holo Transferrin HOMER1 pro-695 Recombinant Human Homer Homolog-1 HOMER2 pro-1072 Recombinant Human Homer Homolog-2 HOMER3 pro-1108 Recombinant Human Homer Homolog-3 HOPX pro-1158 Recombinant Human HOP homeobox HPCAL1 pro-254 Recombinant Human Hippocalcin-Like 1 HPG1 pro-423 Recombinant Human Prostate Specific Gene-1 HRAS pro-822 Recombinant Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog HRSP12 pro-052 Recombinant Human Heat-Responsive Protein 12 HSA pro-354 Human Serum Albumin HSCB pro-1142 Recombinant Human HscB Iron-Sulfur Cluster Co-Chaperone HSD17B10 pro-823 Recombinant Human Hydroxysteroid (17-beta) Dehydrogenase 10 HUS1 pro-039 Recombinant Human HUS1 Checkpoint Homolog ICAM-1 pro-383 Recombinant Human Intercellular Adhesion Molecule-1 ICT1 pro-1303 Recombinant Human Immature Colon Carcinoma Transcript 1 ID2 pro-1383 Recombinant Human Inhibitor of DNA Binding 2 IFT20 pro-1222 Recombinant Human Intraflagellar Transport 20 Homolog IGLL1 pro-1390 Recombinant Human Immunoglobulin Lambda-Like Polypeptide 1 IGJ pro-1416 Recombinant Human Immunoglobulin J IMP3 pro-015 Recombinant Human IMP3 IMPAD1 pro-1346 Recombinant Human Inositol Monophosphatase Domain Containing 1 mIgG pro-1087 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a mIgG His pro-1086 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a, His Tag Intein pro-958 Recombinant Bacillus Circulans Intein Internalin pro-031 Recombinant Listeria Monocytogenes Internalin Intrinsic Factor pro-375 Recombinant Human Intrinsic Factor Involucrin pro-512 Recombinant Human Involucrin IPP-POZ pro-436 Recombinant Human IPP-POZ IRGM pro-1302 Recombinant Human Immunity-Related GTPase Family, M ISCU pro-072 Recombinant Human Iron-sulfur Cluster Scaffold Homolog ISG15 pro-611 Recombinant Human Interferon Stimulated Gene 15 ITGB1BP3 pro-1177 Recombinant Human Integrin Beta 1 Binding Protein 3 JAM2 pro-1336 Recombinant Human Junctional Adhesion Molecule 2 JAM3 pro-1223 Recombinant Human Junctional Adhesion Molecule 3 JOSD1 pro-1251 Recombinant Human Josephin Domain Containing 1 k9Cystatin-C pro-138 Recombinant Canine Cystatin-C KAAG1 pro-192 Recombinant Human Kidney Associated Antigen 1 KCNIP3 pro-009 Recombinant Human Kv Channel Interacting Protein 3 KCTD5 pro-1276 Recombinant Human Potassium Channel Tetramerisation Domain Containing 5 KCTD11 pro-1376 Recombinant Human Potassium Channel Tetramerisation Domain Containing 11 KCTD15 pro-1002 Recombinant Human Potassium Channel Tetramerisation Domain Containing 15 KIN pro-1275 Recombinant Human KIN KIR2DL1 pro-428 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 1 KIR2DL3 pro-429 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 3 KIR2DS4 pro-430 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4 KIR3DL1 pro-427 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 3 Domains Long Cytoplasmic Tail 1 KISS1 pro-419 Recombinant Human KISS-1 Metastasis-Suppressor KLF4 pro-891 Recombinant Human Kruppel-Like Factor 4 KLRB1 pro-1189 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily B, Member 1 KLRC2 pro-1190 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 2 KLRC3 pro-1230 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3 KLRG1 pro-1344 Recombinant Human Killer Cell lectin-like Receptor Subfamily G, Member 1 KLRK1 pro-1290 Recombinant Human Killer Cell lectin-Like Receptor Subfamily K, Member 1 KPNA2 pro-1032 Recombinant Human karyopherin Alpha 2 KPNB1 pro-1001 Recombinant Human karyopherin Beta 1 KRAS pro-854 Recombinant Human Kirsten Rat Sarcoma Viral Oncogene KRT14 pro-348 Recombinant Human Cytokeratin 14 KRT14 His pro-941 Recombinant Human Cytokeratin 14 His Tag KRT18 pro-349 Recombinant Human Cytokeratin 18 KRT18 His pro-484 Recombinant Human Cytokeratin 18 His Tag KRT19 pro-350 Recombinant Human Cytokeratin 19 KRT19 His pro-1347 Recombinant Human Cytokeratin 19 His Tag KRT20 pro-351 Recombinant Human Cytokeratin 20 KRT20 His pro-1358 Recombinant Human Cytokeratin 20 His Tag KRT8 pro-347 Recombinant Human Cytokeratin 8 KRT8 GST pro-298 Recombinant Human Cytokeratin 8 GST-Tag Ku P70/P80 pro-397 Recombinant Human Ku P70/P80 LA/SS-B pro-327 Recombinant Human LA / SS-B LAIR1 pro-431 Recombinant Human Leukocyte-Associated Ig-Like Receptor 1 LAIR2 pro-1081 Recombinant Human Leukocyte-Associated Ig-Like Receptor 2 Lamin-A pro-690 Recombinant Human Lamin-A LAMP2 pro-130 Recombinant Human Lysosomal-Associated Membrane Protein 2 LASP1 pro-1031 Recombinant Human LIM and SH3 Protein 1 LAT pro-948 Recombinant Human Linker for Activation of T Cells LBP pro-538 Recombinant Human Lipopolysaccarid Binding Protein mLBP pro-539 Recombinant Mouse Lipopolysaccarid Binding Protein LDL pro-562 Low Density Lipoprotein LDLRAP1 pro-1033 Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1 LDOC1L pro-1153 Recombinant Human Leucine Zipper, Down-Regulated in Cancer 1-Like LEFTY1 pro-962 Recombinant Human Left-Right Determination Factor 1 LGALS10 pro-744 Recombinant Human Charcot-Leyden Crystal Protein LGALSL pro-1374 Recombinant Human Lectin Galactoside-Binding-Like LIN28A pro-743 Recombinant Human LIN28 LIN28B pro-1249 Recombinant Human LIN28B LIN7A pro-1252 Recombinant Human LIN7A LIN7B pro-1298 Recombinant Human LIN7B LIN7C pro-1305 Recombinant Human LIN7C LITAF pro-1350 Recombinant Human Lipopolysaccharide-Induced TNF Factor LLC pro-561 Human Lambda Light Chain LLO pro-320 Recombinant Listeriolysin-O LLO-pest pro-373 Recombinant Listeriolysin-O PEST-free LRG1 pro-141 Human Leucine-Rich Alpha-2-Glycoprotein 1 LRPAP1 pro-1029 pro-151 L-Selectin pro-381 Recombinant Human L-Selectin LSM1 pro-259 Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated LSM12 pro-1329 Recombinant Human LSM12 Homolog, U6 Small Nuclear RNA Associated LSM2 pro-1069 Recombinant Human LSM2 Homolog, U6 Small Nuclear RNA Associated LSM3 pro-1060 Recombinant Human LSM3 Homolog, U6 Small Nuclear RNA Associated LSM4 pro-065 Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated LTF Holo pro-592 Recombinant Human Lactoferrin Holo LYG2 pro-1245 Recombinant Human Lysozyme G-Like 2 LYN pro-136 Recombinant Human v-yes-1 Yamaguchi Sarcoma Viral Related Oncogene M.Pneumoniae pro-795 Recombinant Mycoplasma Pneumoniae P1-N2 M.Pneumoniae pro-801 Recombinant Mycoplasma Pneumoniae P1-C MAD2L1 pro-934 Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1 MAD2L1BP pro-1052 Recombinant Human MAD2L1 Binding Protein MAF1 pro-921 Recombinant Human MAF1 MAFG pro-968 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene G MAFK pro-025 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene K MAGEA1 pro-311 Recombinant Human Melanoma Antigen Family A, 1 MAGEA3 pro-502 Recombinant Human Melanoma Antigen Family A, 3 MAGEA4 pro-843 Recombinant Human Melanoma Antigen Family A, 4 MAGEA5 pro-1070 Recombinant Human Melanoma Antigen Family A, 5 MAGEA6 pro-1113 Recombinant Human Melanoma Antigen Family A, 6 MAGOH pro-810 Recombinant Human Mago-Nashi Homolog MAP1LC3A pro-495 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Alpha MAP1LC3B pro-076 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta MAP1LC3B2 pro-215 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta 2 MAPKSP1 pro-034 Recombinant Human MAPK Scaffold Protein 1 MAPRE1 pro-058 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 1 MAPRE2 pro-932 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 2 MAPRE3 pro-264 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 3 MAPT pro-295 Recombinant Human Microtubule-Associated Protein Tau MAPT 381a.a. pro-042 Recombinant Human Microtubule-Associated Protein Tau 381 a.a. MAPT 383a.a. pro-012 Recombinant Human Microtubule-Associated Protein Tau 383 a.a. MAPT 412a.a. pro-210 Recombinant Human Microtubule-Associated Protein Tau 412 a.a. MAVS pro-1351 Recombinant Human Mitochondrial Antiviral Signaling Protein MAX pro-811 Recombinant Human MYC Associated Factor X MBD3 pro-1243 Recombinant Human Methyl-CpG Binding Domain Protein 3 MBL2 pro-1285 Recombinant Human Mannose-Binding Lectin 2 MBP pro-616 Recombinant E.Coli Maltose Binding Protein MCFD2 pro-769 Recombinant Human Multiple Coagulation Factor Deficiency 2 MCL1 pro-1202 Recombinant Human Myeloid Cell Leukemia Sequence 1 MCTS1 pro-1387 Recombinant Human Malignant T-Cell-Amplified Sequence 1 MECP2 pro-212 Recombinant Human Methyl CpG Binding Protein 2 MED20 pro-1204 Recombinant Human Mediator Complex Subunit 20 MED4 pro-785 Recombinant Human Mediator Complex Subunit 4 MED7 pro-1319 Recombinant Human Mediator Complex Subunit 7 Melanoma pro-509 Recombinant Human Melanoma (gp100) MEMO1 pro-1148 Recombinant Human Mediator of Cell Motility 1 MESDC2 pro-122 Recombinant Human Mesoderm Development Candidate 2 MET pro-207 Recombinant Human Met Proto-Oncogene MET, GST pro-497 Recombinant Human Met Proto-Oncogene, GST Tag MFAP2 pro-1265 Recombinant Human Microfibrillar-associated Protein 2 MFAP4 pro-1210 Recombinant Human Microfibrillar-associated Protein 4 MGP pro-922 Recombinant Human Matrix Gla Protein MICA pro-367 Recombinant Human MHC class I chain-related gene A MICB pro-368 Recombinant Human MHC class I chain-related gene B MIS12 pro-022 Recombinant Human MIS12 MLF1 pro-100 Recombinant Human Myeloid Leukemia Factor 1 MMACHC pro-1119 Recombinant Human Methylmalonic Aciduria cblC type, with Homocystinuria MNDA pro-763 Recombinant Human Myeloid Cell Nuclear Differentiation Antigen MOBKL1B pro-068 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 1B MOBLK3 pro-049 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3 MOCS2 pro-1281 Recombinant Human Molybdenum Cofactor Synthesis 2 MOG pro-371 Myelin Oligodendrocyte Glycoprotein MOG pro-466 Recombinant Human Myelin Oligodendrocyte Glycoprotein MORF4L1 pro-1078 Recombinant Human Mortality Factor 4 Like 1 MORF4L2 pro-475 Recombinant Human Mortality Factor 4 Like 2 MRAS pro-1008 Recombinant Human Muscle RAS Oncogene Homolog MRM1 pro-1416 Recombinant Human Mitochondrial RRNA Methyltransferase 1 MRRF pro-1299 Recombinant Human Mitochondrial Ribosome Recycling Factor MRTO4 pro-1233 Recombinant Human mRNA Turnover 4 MRPL28 pro-1279 Recombinant Human Mitochondrial Ribosomal Protein L28 MRPL13 pro-1404 Recombinant Human Mitochondrial Ribosomal Protein L13 MSH6 pro-745 Recombinant Human MutS Homolog 6 MXD3 pro-1356 Recombinant Human MAX Dimerization Protein 3 MUTED pro-1155 Recombinant Human MUTED MYC pro-087 Recombinant Human V-Myc Myelocytomatosis Viral Oncogene MYCBP pro-942 Recombinant Human C-Myc Binding Protein MYD88 pro-1377 Recombinant Human Myeloid Differentiation Primary Response 88 MYL1 pro-365 Recombinant Human Myosin Light Chain 1 MYL12A pro-902 Recombinant Human Myosin Light Chain 12A MYL12B pro-1124 Recombinant Human Myosin Light Chain 12B MYL2 pro-524 Recombinant Human Myosin Light Chain 2 MYL4 pro-992 Recombinant Human Myosin Light Chain 4 MYL5 pro-916 Recombinant Human Myosin Light Chain 5 MYL5 (1-173 a.a.) pro-943 Recombinant Human Myosin Light Chain 5 (1-173 a.a.) MYL6 pro-171 Recombinant Human Myosin Light Chain 6 MYL6B pro-964 Recombinant Human Myosin Light Chain 6B MYL7 pro-1109 Recombinant Human Myosin Light Chain 7 MYL9 pro-107 Recombinant Human Myosin Light Chain 9 MYLPF pro-243 Recombinant Human Myosin Light chain, Phosphorylatable, Fast Skeletal Muscle Myoglobin pro-336 Recombinant Human Myoglobin Myoglobin pro-565 Human Myoglobin Myoglobin heme free pro-374 Recombinant Human Myoglobin Heme free Myoglobin His pro-071 Recombinant Human Myoglobin, His Tag NACA pro-974 Recombinant Human Nascent Polypeptide-Associated Complex Alpha NANOG pro-896 Recombinant Human Nanog NANOG, His pro-881 Recombinant Human Nanog, His Tag NANOG-TAT pro-090 Recombinant Human Nanog-TAT NAP1L1 pro-985 Recombinant Human Nucleosome Assembly Protein 1-Like 1 NAPA pro-250 Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Alpha NAPG pro-944 Rcombinant Human N-ethylmaleimide-Sensitive Factor Attachment Protein, Gamma NBL1 pro-1365 Recombinant Human Neuroblastoma 1 NCALD pro-093 Recombinant Human Neurocalcin Delta NCBP2 pro-265 Recombinant Human Nuclear Cap Binding Protein Subunit 2 NCEH1 pro-1393 Recombinant Human Neutral Cholesterol Ester Hydrolase 1 NCF1 pro-488 Recombinant Human Neutrophil Cytosolic Factor 1 NCF4 pro-1258 Recombinant Human Neutrophil Cytosolic Factor 4 NCK1 pro-839 Recombinant Human NCK Adaptor Protein 1 NCS1 pro-802 Recombinant Human Neuronal Calcium Sensor 1 NDE1 pro-204 Recombinant Human nudE Nuclear Distribution Gene E Homolog 1 NDRG1 pro-724 Recombinant Human N-Myc Downstream Regulated 1 NDRG2 pro-1198 Recombinant Human N-Myc Downstream Regulated 2 NECAP2 pro-180 Recombinant Human NECAP Endocytosis Associated 2 NFKBIA pro-960 Recombinant Human NF-kappa-B Inhibitor Alpha NFKBIB pro-1046 Recombinant Human NF-kappa-B Inhibitor Beta NHEJ1 pro-1193 Recombinant Human Nonhomologous End-Joining Factor 1 NHP2 pro-067 Recombinant Human NHP2 Ribonucleoprotein Homolog NHP2L1 pro-038 Recombinant Human NHP2 Non-Histone Chromosome Protein 2-Like NIP7 pro-780 Recombinant Human Nuclear Import 7 Homolog NKIRAS1 pro-1039 Recombinant Human NFKB Inhibitor Interacting Ras-Like 1 NKIRAS2 pro-1091 Recombinant Human NFKB Inhibitor Interacting Ras-Like 2 NKp46 pro-432 Recombinant Human Natural Cytotoxicity Receptor NKp46 NKX3-1 pro-1341 Recombinant Human NK3 Homeobox 1 NME1 pro-715 Recombinant Human Non-Metastatic Cells 1 NME3 pro-082 Recombinant Human Non-Metastatic Cells 3 NME4 pro-219 Recombinant Human Non-Metastatic Cells 4 NMI pro-070 Recombinant Human N-Myc Interactor NMM pro-366 Recombinant Human Non-Muscle Myosin-II Regulatory Light Chain NMRAL1 pro-1131 Recombinant Human NmrA-Like Family Domain Containing 1 NOL3 pro-1178 Recombinant Human Nucleolar Protein 3 6 pro-1340 Recombinant Human 6 NPM1 pro-1120 Recombinant Human Nucleophosmin NPM2 pro-1182 Recombinant Human Nucleophosmin 2 NR1H2 pro-869 Recombinant Human Nuclear Receptor Subfamily 1 Group H, Member 2 NRAS pro-794 Recombinant Human Neuroblastoma RAS Viral Oncogene Homolog NRIP3 pro-1384 Recombinant Human Nuclear Receptor-Interacting Protein 3 NTAL pro-827 Recombinant Human Non-T-cell Activation Linker NTS pro-1311 Recombinant Human Neurotensin NUCB2 pro-492 Recombinant Human Nucleobindin-2 NUCB2, His pro-142 Recombinant Human Nucleobindin-2, His Tag mNUCB2 pro-605 Recombinant Mouse Nucleobindin-2 NUP210 pro-109 Recombinant Human Nucleopurin 210kDa NUP62 pro-999 Recombinant Human Nucleopurin 62kDa NusA pro-623 Recombinant E.Coli Transcription Termination/Antitermination L Factor NUTF2 pro-844 Recombinant Human Nuclear Transport Factor 2 NXT1 pro-218 Recombinant Human NTF2-like Export Factor 1 NXT2 pro-1051 Recombinant Human NTF2-like Export Factor 2 NY-ESO-1 pro-531 Recombinant Human New York Esophageal Squamous Cell Carcinoma OAZ1 pro-1200 Recombinant Human Ornithine Decarboxylase Antizyme 1 OBFC1 pro-028 Recombinant Human Oligonucleotide Binding Fold Containing 1 OCM pro-143 Recombinant Human Oncomodulin-1 OLR1 pro-923 Recombinant Human Oxidized Low Density Lipoprotein Receptor 1 OMP pro-1412 Recombinant Human Olfactory Marker Protein Omp Pylori pro-369 Recombinant Helicobacter Pylori Outer Membrane Protein OmpA pro-571 Recombinant Bacterial Outer Membrane Protein-A ORAOV1 pro-1092 Recombinant Human Oral Cancer Overexpressed 1 ORM1 pro-889 Recombinant Human Orosomucoid 1 Osteocrin pro-420 Recombinant Human Osteocrin OTUB1 pro-711 Recombinant Human Ubiquitin Aldehyde Binding 1 OTUB2 pro-214 Recombinant Human Ubiquitin Aldehyde Binding 2 OVCA2 pro-1123 Recombinant Human Ovarian Tumor Suppressor Candidate 2 p53 pro-742 Recombinant Human p53 p53 Mutant pro-301 Recombinant Human p53 Mutant PA2G4 pro-782 Recombinant Human Proliferation-associated protein 2G4 PAEP pro-1397 Recombinant Human Progesterone-Associated Endometrial Protein PAIP2 pro-748 Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2 PARD6B pro-1307 Recombinant Human Par-6 Partitioning Defective 6 Homolog Beta PARK7 pro-575 Recombinant Human Parkinson Disease Protein 7 PARVA pro-1257 Recombinant Human Parvin Alpha PBLD pro-010 Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing pCD163 pro-856 Recombinant Porcine CD163 PCNA pro-615 Recombinant Human Proliferating Cell Antigen PCNA GST pro-741 Recombinant Human Proliferating Cell Antigen, GST Tag PCNA Sf9 pro-303 Recombinant Human Proliferating Cell Antigen, S9 PCNP pro-906 Recombinant Human PEST proteolytic Signal Containing Nuclear Protein PDAP1 pro-490 Recombinant Human PDGFA Associated Protein 1 PDCD4 pro-606 Recombinant Human ProgrammedCell Death 4 PDCD5 pro-624 Recombinant Human Programmed Cell Death 5 PDCD6 pro-184 Recombinant Human Programmed Cell Death 6 PDCD6IP pro-792 Recombinant Human ProgrammedCell Death 6 Interacting Protein PDCL pro-1141 Recombinant Human Phosducin-Like PDCL3 pro-1028 Recombinant Human Phosducin-Like 3 PDPN pro-626 Recombinant Human Podoplanin PDRG1 pro-007 Recombinant Human p53 and DNA-Damage Regulated 1 PDZD11 pro-1263 Recombinant Human PDZ Domain Containing 11 PEA15 pro-729 Recombinant Human Phosphoprotein Enriched in Astrocytes 15 PEBP1 pro-722 Recombinant Human Phosphatidylethanolamine Binding Protein 1 PEF1 pro-099 Recombinant Human Penta-EF-Hand Domain Containing 1 PEX pro-360 Recombinant Human C-terminal hemopexin-like domain of MMP-2 (445-635 a.a.) PEX19 pro-925 Recombinant Human Peroxisomal Biogenesis Factor 19 PFDN1 pro-277 Recombinant Human Prefoldin Subunit 1 PFDN2 pro-001 Recombinant Human Prefoldin Subunit 2 PFDN4 pro-092 Recombinant Human Prefoldin Subunit 4 PFDN5 pro-901 Recombinant Human Prefoldin Subunit 5 PFDN6 pro-178 Recombinant Human Prefoldin Subunit 6 PFN1 pro-528 Recombinant Human Profilin-1 PFN2 pro-809 Recombinant Human Profilin-2 PFN4 pro-818 Recombinant Human Profilin-4 PGP9.5 pro-576 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 PGP9.5 GST pro-304 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag PGR pro-535 Recombinant Human Progesterone Receptor PHB pro-1381 Recombinant Human Prohibitin PHF11 pro-1268 Recombinant Human PHD Finger Protein 11 PHLDA2 pro-781 Recombinant Human Pleckstrin Homology-Like Domain Family A Member 2 PIM1 pro-1389 Recombinant Human PIM1 PINX1 pro-693 Recombinant Human PIN2-Interacting Protein 1 PIR pro-1040 Recombinant Human Pirin PITPNA pro-044 Recombinant Human Phosphatidylinositol Transfer Protein, Alpha PITPNB pro-003 Recombinant Human Phosphatidylinositol Transfer Protein, Beta PLDN pro-1068 Recombinant Human Pallidin Homolog PLSCR1 pro-1271 Recombinant Human Phospholipid Scramblase 1 PMP2 pro-651 Recombinant Human Peripheral Myelin Protein-2 PMP2 His pro-671 Recombinant Human Peripheral Myelin Protein-2, His Tag POLR2J pro-1260 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide J POLR3H pro-1250 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide H POMC pro-236 Recombinant Human Proopiomelanocortin POP4 pro-1407 Recombinant Human Processing Of Precursor 4 POU2AF1 pro-880 Recombinant Human POU class 2 associating factor 1 POU5F1 pro-088 Recombinant Human POU Class 5 Homeobox 1 POU5F1 PolyR pro-091 Recombinant Human POU Class 5 Homeobox 1 Polyarginine-Tag PQBP1 pro-1101 Recombinant Human Polyglutamine Binding Protein 1 Prealbumin pro-771 Recombinant Human Transthyretin Prelamin-A pro-689 Recombinant Prelamin-A PRND pro-018 Recombinant Human Prion Protein 2 PRNP pro-1400 Recombinant Human Prion Protein PROC pro-485 Recombinant Human Protein-c Protein-A/G pro-646 Recombinant Protein A/G Protein-G pro-402 Recombinant Protein G Protein-G His pro-1237 Recombinant Protein G His Tag Prothrombin pro-439 Human Prothrombin Complex P-Selectin pro-382 Recombinant Human P-Selectin PSMA pro-740 Recombinant Human Prostate Specific Membrane Antigen PSMB10 pro-931 Recombinant Human Proteasome Beta Type 10 PSME1 pro-266 Recombinant Human Proteasome Activator Subunit 1 PSME2 pro-975 Recombinant Human Proteasome Activator Subunit 2 PSME3 pro-987 Recombinant Human Proteasome Activator Subunit 3 PSMG2 pro-930 Recombinant Human Proteasome Assembly Chaperone 2 PSMG3 pro-261 Recombinant Human Proteasome Assembly Chaperone 3 PSMG4 pro-989 Recombinant Human Proteasome Assembly Chaperone 4 PSP94 pro-598 Recombinant Human Beta-Microseminoprotein PTEN pro-305 Recombinant Human Phosphatase and Tensin Homolog PTEN His pro-712 Recombinant Human Phosphatase and Tensin homolog His Tag PTGDS pro-316 Recombinant Human Beta-Trace pThrombin pro-617 Porcine Thrombin pTrypsin pro-787 Recombinant Porcine Trypsin PTTG1 pro-717 Recombinant Human Pituitary Tumor-Transforming Protein 1 PTX3 pro-694 Recombinant Human Pentraxin-3 PVALB pro-004 Recombinant Human Parvalbumin RAB10 pro-1361 Recombinant Human RAB10, Member RAS Oncogene Family RAB11A pro-826 Recombinant Human RAB11A, Member RAS Oncogene Family RAB13 pro-882 Recombinant Human RAB13, Member RAS Oncogene Family RAB14 pro-873 Recombinant Human RAB14, Member RAS Oncogene Family RAB17 pro-874 Recombinant Human RAB17, Member RAS Oncogene Family RAB18 pro-976 Recombinant Human RAB18, Member RAS Oncogene Family RAB1A pro-097 Recombinant Human RAB1A, Member RAS Oncogene Family RAB1B pro-045 Recombinant Human RAB1B, Member RAS Oncogene Family RAB21 pro-101 Recombinant Human RAB21, Member RAS Oncogene Family RAB22A pro-929 Recombinant Human RAB22, Member RAS Oncogene Family RAB23 pro-977 Recombinant Human RAB23, Member RAS Oncogene Family RAB24 pro-951 Recombinant Human RAB24, Member RAS Oncogene Family RAB27A pro-825 Recombinant Human RAB27A, Member RAS Oncogene Family RAB27B pro-075 Recombinant Human RAB27B, Member RAS Oncogene Family RAB2A pro-244 Recombinant Human RAB2A, Member RAS Oncogene Family RAB2B pro-1013 Recombinant Human RAB2B, Member RAS Oncogene Family RAB31 pro-1090 Recombinant Human RAB31, Member RAS Oncogene Family RAB32 pro-950 Recombinant Human RAB32, Member RAS Oncogene Family RAB34 pro-978 Recombinant Human RAB34, Member RAS Oncogene Family RAB35 pro-935 Recombinant Human RAB35, Member RAS Oncogene Family RAB3A pro-870 Recombinant Human RAB3A, Member RAS Oncogene Family RAB3B pro-875 Recombinant Human RAB3B, Member RAS Oncogene Family RAB3D pro-247 Recombinant Human RAB3D, Member RAS Oncogene Family RAB4A pro-871 Recombinant Human RAB4A, Member RAS Oncogene Family RAB5A pro-590 Recombinant Human RAB5A, Member RAS Oncogene Family RAB5B pro-056 Recombinant Human RAB5B, Member RAS Oncogene Family RAB6A pro-047 Recombinant Human RAB6A, Member RAS Oncogene Family RAB6B pro-103 Recombinant Human RAB6B, Member RAS Oncogene Family RAB7A pro-077 Recombinant Human RAB7A, Member RAS Oncogene Family RABIF pro-300 Recombinant Human RAB Interacting Factor RAC1 pro-572 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 RAC1 His pro-731 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 His Tag RAC2 pro-619 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 RAC2 (189) pro-719 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 (1-189) RAC3 pro-073 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3 RAD1 pro-868 Recombinant Human RAD1 RAET1E pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E RALA pro-043 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog A RALB pro-053 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog B RAMP3 pro-1367 Recombinant Human Receptor Activity-Modifying Protein 3 RAN pro-841 Recombinant Human RAN, Member RAS Oncogene Family RANBP1 pro-1064 Recombinant Human RAN Binding Protein 1 RANGRF pro-1149 Recombinant Human RAN Guanine Nucleotide Release Factor RAP1A pro-848 Recombinant Human RAP1A, Member RAS Oncogene Family RAP1B pro-083 Recombinant Human RAP1B, Member RAS Oncogene Family RAP2B pro-1364 Recombinant Human RAP2B, Member RAS Oncogene Family RAP2A pro-061 Recombinant Human RAP2A, Member RAS Oncogene Family RARA pro-596 Recombinant Retnoid Acid Receptor Alpha RARRES2 pro-788 Recombinant Human Retinoic Acid Receptor Responder 2 RASSF1A pro-1288 Recombinant Human Ras association domain-containing protein 1 RASSF3 pro-1378 Recombinant Human Ras Association Domain-Containing Protein 3 RB1 pro-584 Recombinant Human Retinoblastoma Associated Protein RBBP4 pro-1168 Recombinant Human Retinoblastoma Binding Protein 4 RBBP9 pro-991 Recombinant Human Retinoblastoma Binding Protein 9 RBM8A pro-186 Recombinant Human RNA Binding Motif Protein 8A rCALB1 pro-400 Recombinant Rat Calbindin-1 RCAN1 pro-319 Recombinant Human Regulator of Calcineurin 1 RCAN2 pro-990 Recombinant Human Regulator of Calcineurin 2 RCAN3 pro-1284 Recombinant Human Regulator of Calcineurin 3 RCN1 pro-544 Recombinant Human Reticulocalbin 1 RCN2 pro-189 Recombinant Human Reticulocalbin 2 RCN3 pro-1049 Recombinant Human Reticulocalbin 3 RCVRN pro-441 Recombinant Human Recoverin RDBP pro-181 Recombinant Human RD RNA Binding Protein REG1A pro-289 Recombinant Human Regenerating Islet-Derived 1 Alpha REG1B pro-391 Recombinant Human Regenerating Islet-Derived 1 Beta REG3A pro-421 Recombinant Human Regenerating Islet-Derived 3 Alpha REG4 pro-424 Recombinant Human Regenerating Islet-Derived 4 RERG pro-106 Recombinant Human RAS-like, Estrogen-Regulated, Growth Inhibitor rFibronectin pro-131 Rat Fibronectin rGFP pro-687 Recombinant Green Fluorescent Protein RGN pro-915 Recombinant Human Regucalcin RGS1 pro-1118 Recombinant Human Regulator of G-Protein Signaling 1 RGS10 pro-890 Recombinant Human Regulator of G-Protein Signaling 10 RGS14 pro-1151 Recombinant Human Regulator of G-Protein Signaling 14 RGS16 pro-798 Recombinant Human Regulator of G-Protein Signaling 16 RGS17 pro-924 Recombinant Human Regulator of G-Protein Signaling 17 RGS19 pro-037 Recombinant Human Regulator of G-Protein Signaling 19 RGS2 pro-182 Recombinant Human Regulator of G-Protein Signaling 2 RGS21 pro-898 Recombinant Human Regulator of G-Protein Signaling 21 RGS4 pro-900 Recombinant Human Regulator of G-Protein Signaling 4 RGS5 pro-905 Recombinant Human Regulator of G-Protein Signaling 5 RHEB pro-308 Recombinant Human Ras Homolog Enriched in Brain RHOA pro-057 Recombinant Human Ras Homolog Gene Family Member A RHOB pro-224 Recombinant Human Ras Homolog Gene Family Member B RHOC pro-865 Recombinant Human Ras Homolog Gene Family Member C RHOD pro-190 Recombinant Human Ras Homolog Gene Family Member D RHOG pro-1136 Recombinant Human Ras Homolog Gene Family Member G RHOV pro-1199 Recombinant Human Ras Homolog Gene Family Member V rHSA HEK pro-967 Recombinant Human Serum Albumin, HEK rHSA Plant pro-595 Recombinant Human Serum Albumin, Plant RLN2 pro-1327 Recombinant Human Relaxin-2 rmS100b pro-1236 Recombinant Rhesus Macaque S100 Calcium Binding Protein B RND1 pro-893 Recombinant Human Rho Family GTPase 1 RND3 pro-487 Recombinant Human Rho Family GTPase 3 RNF181 pro-1218 Recombinant Human Ring Finger Protein 181 RNF4 pro-1255 Recombinant Human Ring Finger Protein 4 ROBLD3 pro-050 Recombinant Human Roadblock Domain Containing 3 RORC pro-206 Recombinant Human RAR-Related Orphan Receptor C RP9 pro-1314 Recombinant Human Retinitis Pigmentosa 9 RPA2 pro-011 Recombinant Human Replication Protein A2 RPL26L1 pro-1242 Recombinant Human Ribosomal Protein L26-Like 1 RPL8 pro-1053 Recombinant Human Ribosomal Protein L8 RPLP0 pro-392 Recombinant Human Ribosomal Phosphoprotein P0 RPLP1 pro-127 Recombinant Human Ribosomal Phosphoprotein P1 RPLP2 pro-128 Recombinant Human Ribosomal Phosphoprotein P2 RPS3 pro-954 Recombinant Human Ribosomal Protein S3 RPS3A pro-1125 Recombinant Human Ribosomal Protein S3A RPS5 pro-1300 Recombinant Human Ribosomal Protein S5 RPS7 pro-993 Recombinant Human Ribosomal Protein S7 RPS10 pro-1409 Recombinant Human Ribosomal Protein S10 RPS14 pro-118 Recombinant Human Ribosomal Protein S14 rPVALB pro-398 Recombinant Rat Parvalbumin RQCD1 pro-008 Recombinant Human RCD1 Required for Cell Differentiation1 RRAGC pro-1050 Recombinant Human Ras-Related GTP Binding C rRAP pro-352 Recombinant Rat Receptor Associated Protein RRAS pro-808 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog RRAS2 pro-728 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog 2 rSCGN pro-657 Recombinant Rat Secretagogin RSG1 pro-1334 Recombinant Human REM2 and RAB-Like Small GTPase 1 RTN4IP1 pro-1014 Recombinant Human Reticulon 4 Interacting Protein 1 rTpc1808 pro-587 Recombinant Rat Tropic 1808 rTroponin-C pro-323 Rabbit Skeletal Muscle Troponin-C RUNX3 pro-836 Recombinant Human Runt-Related Transcription Factor 3 RUVBL1 pro-861 Recombinant Human RuvB-Like 1 rVCAM1 pro-361 Recombinant Rabbit Vascular cell adhesion molecule 1 RWDD1 pro-1309 Recombinant Human RWD Domain Containing 1 RXRA pro-437 Recombinant Human Retinoid X Receptor Alpha RYBP pro-1139 Recombinant Human RING1 & YY1 Binding Protein S100A1 pro-364 Recombinant Human S100 Calcium Binding Protein A1 mS100A1 pro-237 Recombinant Mouse S100 Calcium Binding Protein A1 S100A10 pro-384 Recombinant Human S100 Calcium Binding Protein A10 S100A11 pro-385 Recombinant Human S100 Calcium Binding Protein A11 S100A12 pro-152 Recombinant Human S100 Calcium Binding Protein A12 S100A13 pro-153 Recombinant Human S100 Calcium Binding Protein A13 S100A14 pro-154 Recombinant Human S100 Calcium Binding Protein A14 S100A16 pro-155 Recombinant Human S100 Calcium Binding Protein A16 S100A2 pro-146 Recombinant Human S100 Calcium Binding Protein A2 S100A3 pro-755 Recombinant Human S100 Calcium Binding Protein A3 mS100A3 pro-1166 Recombinant Mouse S100 Calcium Binding Protein A3 S100A4 pro-307 Recombinant Human S100 Calcium Binding Protein A4 S100A4 His pro-698 Recombinant Human S100 Calcium Binding Protein A4 His Tag mS100A4 pro-229 Recombinant Mouse S100 Calcium Binding Protein A4 S100A5 pro-147 Recombinant Human S100 Calcium Binding Protein A5 mS100A5 pro-1084 Recombinant Mouse S100 Calcium Binding Protein A5 S100A6 pro-148 Recombinant Human S100 Calcium Binding Protein A6 mS100A6 pro-409 Mouse S100 Calcium Binding Protein A6 mS100A6 pro-240 Recombinant Mouse S100 Calcium Binding Protein A6 S100A7 pro-149 Recombinant Human S100 Calcium Binding Protein A7 S100A7A pro-756 Recombinant Human S100 Calcium Binding Protein A7A S100A8 pro-800 Recombinant Human S100 Calcium Binding Protein A8 S100A8, His pro-150 Recombinant Human S100 Calcium Binding Protein A8, His Tag mS100A8 pro-233 Recombinant Mouse S100 Calcium Binding Protein A8 S100A9 pro-814 Recombinant Human S100 Calcium Binding Protein A9 S100A9, His pro-151 Recombinant Human S100 Calcium Binding Protein A9, His Tag mS100A9 pro-878 Recombinant Mouse S100 Calcium Binding Protein A9 S100b pro-306 Recombinant Human S100 Calcium Binding Protein B mS100b pro-853 Recombinant Mouse S100 Calcium Binding Protein B S100b GST pro-737 Recombinant Human S100 Calcium Binding Protein B, GST Tag S100G pro-399 Recombinant Rat S100 Calcium Binding Protein G S100G pro-156 Recombinant Human S100 Calcium Binding Protein G S100P pro-425 Recombinant Human S100 Calcium Binding Protein P S100P His pro-830 Recombinant Human S100 Calcium Binding Protein P, His Tag S100Z pro-840 Recombinant HumanS100 Calcium Binding Protein Z mS100A15 pro-1145 Recombinant Mouse S100 Calcium Binding Protein A15 SAMD13 pro-355 Recombinant Human Sterile Alpha Motif Domain Containing 13 SAP18 pro-707 Recombinant Human Sin3A-Associated Protein, 18kDa SAR1A pro-709 Recombinant Human GTP-Binding Protein SAR1A SAR1B pro-310 Recombinant Human GTP-Binding Protein SAR1B SBDS pro-272 Recombinant Human Shwachman-Bodian-Diamond Syndrome SCAND1 pro-269 Recombinant Human SCAN domain containing 1 SCG5 pro-467 Recombinant Human Secretogranin V SCGB2A2 pro-515 Recombinant Human Mammaglobin-A SCGN pro-599 Recombinant Human Secretagogin SCO2 pro-054 Recombinant Human SCO Cytochrome Oxidase Deficient Homolog 2 SDC1 pro-1065 Recombinant Human Syndecan-1 SDC1, GST pro-516 Recombinant Human Syndecan-1, GST tag SDC4 pro-778 Recombinant Human Syndecan-4 SDC4, His pro-583 Recombinant Human Syndecan-4, His Tag SDCBP pro-036 Recombinant Human Syndecan Binding Protein SDCBP2 pro-1297 Recombinant Human Syndecan Binding Protein 2 SDHAF2 pro-593 Recombinant Human Succinate Dehydrogenase Complex Assembly Factor 2 SDR16C5 pro-1385 Recombinant Human Short Chain Dehydrogenase/Reductase Family 16C, Member 5 SEC13 pro-194 Recombinant Human SEC13 SEC22B pro-1212 Recombinant Human SEC22 Homolog B SecB pro-697 Recombinant Protein Export Protein SecB SEPT2 pro-255 Recombinant Human Septin-2 SEPT5 pro-879 Recombinant Human Septin-5 SEPT6 pro-949 Recombinant Human Septin-6 SEPX1 pro-260 Recombinant Human Selenoprotein X 1 SERPINA1 pro-456 Human Alpha-1 Antitrypsin SERPINA1 pro-529 Recombinant Human Alpha-1 Antitrypsin SERPINA1, Active pro-907 Recombinant Human Alpha-1 Antitrypsin, Active SERPINA3 pro-750 Recombinant Human Alpha-1 AntiChymotrypsin SERPINA3 pro-378 Human Alpha-1 AntiChymotrypsin SERPINA5 pro-749 Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 5 SERPINB5 pro-202 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5 SERPINB5 His pro-704 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5, His Tag SERPING1 pro-1401 Recombinant Human Serpin Peptidase Inhibitor, Clade G Member 1 SERPINI1 pro-213 Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1 SERTAD1 pro-1157 Recombinant Human SERTA Domain Containing 1 SF3B14 pro-105 Recombinant Human Splicing Factor 3B, 14 kDa Subunit SGCD pro-1373 Recombinant Human Sarcoglycan Delta SGTA pro-807 Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha SH2D1A pro-006 Recombinant Human SH2 domain containing 1A SH3BGRL pro-1159 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like SH3BGRL2 pro-1215 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2 SH3BGRL3 pro-1216 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3 SH3GL2 pro-1083 Recombinant Human SH3-domain GRB2-like 2 SH3GLB1 pro-1278 Recombinant Human SH3-domain GRB2-like endophilin B1 SH3GLB2 pro-1287 Recombinant Human SH3-domain GRB2-like endophilin B2 SHC1 pro-883 Recombinant Human SHC-Transforming Protein 1 SIL1 pro-1187 Recombinant Human SIL1 SIRT2 pro-033 Recombinant Human SIrtuin-2 SIRT3 pro-462 Recombinant Human SIrtuin-3 SIRT6 pro-282 Recombinant Human SIrtuin-6 SIT1 pro-928 Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1 SIX1 pro-1226 Recombinant Human SIX Homeobox 1 SIX6 pro-1253 Recombinant Human SIX Homeobox 6 SLAMF1 pro-1342 Recombinant Human SLAMF1 SLAMF6 pro-1286 Recombinant Human SLAMF6 SLC4A4 pro-688 Recombinant Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4 SLPI pro-849 Recombinant Human Secretory Leukocyte Peptidase Inhibitor SMAC/DIABLO pro-614 Recombinant Human SMAC/DIABLO SMAD2 pro-691 Recombinant Human SMAD Family Member 2 SMAD3 pro-751 Recombinant Human Mothers Against Decapentaplegic Homolog 3 SMAD4 pro-459 Recombinant Human Mothers Against Decapentaplegic Homolog 4 SMNDC1 pro-035 Recombinant Human Survival Motor Neuron Domain Containing 1 SNAP23 pro-659 Recombinant Human Synaptosomal-associated protein 23kDa SNAP25 pro-573 Recombinant Human Synaptosomal-associated protein 25kDa SNAP-25 pro-396 Recombinant Synaptosomal-associated protein 25kDa, C.elegans SNAP25B pro-635 Recombinant Human Synaptosomal-associated protein 25B SNAPIN pro-663 Recombinant Human SNAP Associated Protein SNCA pro-393 Recombinant Human Alpha-Synuclein SNCA 1-60 pro-165 Recombinant Human Alpha-Synuclein 1-60 SNCA 61-140 pro-163 Recombinant Human Alpha-Synuclein 61-140 SNCA 96-140 pro-164 Recombinant Human Alpha-Synuclein 96-140 SNCA A30P pro-158 Recombinant Human Alpha-Synuclein A30P SNCA A30P/A53T pro-160 Recombinant Human Alpha-Synuclein A30P/A53T SNCA A53T pro-159 Recombinant Human Alpha-Synuclein A53T SNCA Delta-NAC pro-161 Recombinant Human Alpha-Synuclein Delta-NAC SNCA NACP112 pro-162 Recombinant Human Alpha-Synuclein NACP112 CA pro-858 Recombinant Mouse Alpha-Synuclein SNCB pro-394 Recombinant Human Beta-Synuclein SNCG pro-395 Recombinant Human Gamma-Synuclein SNF8 pro-1135 Recombinant Human SNF8, ESCRT-II Complex Subunit SNIP1 pro-201 Recombinant Human Smad Nuclear Interacting Protein 1 SNPH pro-545 Recombinant Human Syntaphilin SNRNP25 pro-226 Recombinant Human Small Nuclear Ribonucleoprotein 25kDa SNRNP70 pro-445 Recombinant Human Small Nuclear Ribonucleoprotein 70kDa SNRPA1 pro-1015 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide A SNRPB2 pro-217 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide B SNRPC pro-1004 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C SNRPD pro-997 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1, D2, D3 SNRPD1 pro-994 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1 SNRPD2 pro-123 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2 SNRPD2, Sf9 pro-995 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2, Sf9 SNRPD3 pro-945 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3 SNRPD3, Sf9 pro-996 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3, Sf9 SNRPE pro-104 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide E SNRPF pro-041 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide F SNRPG pro-196 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide G SNTA1 pro-1016 Recombinant Human Syntrophin, Alpha 1 SNTN pro-216 Recombinant Human Sentan Cilia Apical Structure Protein SNUPN pro-866 Recombinant Human Snurportin 1 SNX1 pro-665 Recombinant Human Sorting Nexin 1 SNX3 pro-246 Recombinant Human Sorting Nexin 3 SOD pro-286 Recombinant Human Superoxide Dismutase SOD His pro-1239 Recombinant Human Superoxide Dismutase His Tag SOD1 pro-648 Recombinant Human Superoxide Dismutase-1 SOD2 pro-819 Recombinant Human Superoxide Dismutase-2 SODA pro-208 Recombinant E.Coli Superoxide Dismutase SOSTDC1 pro-426 Recombinant Human Sclerostin Domain Containing 1 SOX2 pro-820 Recombinant Human SRY (sex determining region Y)-box 2 SOX2 PolyR pro-089 Recombinant Human SRY (sex determining region Y)-box 2 Polyarginine-Tag Sox2-TAT pro-1343 Recombinant Human SRY (sex determining region Y)-box 2 TAT SOX9 pro-739 Recombinant Human SOX9 SP100 pro-108 Recombinant Human SP100 SPA pro-356 Recombinant Staphylococcal Protein-A SPA 41kDa pro-774 Recombinant Staphylococcal Protein-A 41kDa SPA 434a.a. pro-686 Recombinant Staphylococcal Protein A 434 a.a SPARC pro-582 Recombinant Human Secreted Protein Acidic & Rich in Cysteine SPG21 pro-677 Recombinant Human Spastic Paraplegia 21 SPIN1 pro-1184 Recombinant Human Spindlin-1 SPINT pro-1296 Recombinant Human Serine Peptidase Inhibitor, Kunitz Type 2 SPOP pro-195 Recombinant Human Speckle-Type POZ Protein SPSB1 pro-223 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 1 SPSB2 pro-1264 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 2 SQSTM1 pro-806 Recombinant Human Sequestosome 1 SRA1 pro-1274 Recombinant Human Steroid Receptor RNA Activator 1 sRAGE pro-600 Recombinant Human Advanced Glycosylation End Product-Specific Receptor sRAGE HEK pro-601 Recombinant Human Advanced Glycosylation End Product-Specific Receptor, HEK SRSF1 pro-1352 Recombinant Human Serine/arginine-Rich Splicing Factor 1 SRGN pro-965 Recombinant Human Serglycin SRI pro-166 Recombinant Human Sorcin SRP14 pro-013 Recombinant Human Signal Recognition Particle 14kDa SRP54 pro-113 Recombinant Human Signal Recognition Particle 54kDa SSBP1 pro-1408 Recombinant Human Single-Stranded DNA Binding Protein 1 SSR2 pro-1380 Recombinant Human Signal Sequence Receptor, Beta SSR4 pro-1294 Recombinant Human Signal Sequence Receptor, Delta SSX1 pro-1379 Recombinant Human Synovial Sarcoma, X Breakpoint 1 STAMBP pro-017 Recombinant Human STAM Binding Protein STAMBPL1 pro-1354 Recombinant Human STAM Binding Protein Like 1 STAP1 pro-1110 Recombinant Human Signal Transducing Adaptor Family Member 1 STAR pro-979 Recombinant Human Steroidogenic Acute Regulatory Protein STIM1 pro-620 Recombinant Human Stromal Interaction Molecule 1 STIP1 pro-753 Recombinant Human Stress-Induced-Phosphoprotein 1 STMN1 pro-676 Recombinant Human Stathmin-1 STMN2 pro-752 Recombinant Human Stathmin Like-2 STMN3 pro-838 Recombinant Human Stathmin Like-3 Streptavidin pro-283 Streptavidin Streptavidin pro-791 Recombinant Streptavidin Streptavidin, His pro-621 Recombinant Streptavidin, His Tag Streptavidin-NC pro-338 Recombinant Streptavidin-NC STX11 pro-1111 Recombinant Human Syntaxin-11 STX12 pro-1099 Recombinant Human Syntaxin-12 STX1A pro-574 Recombinant Human Syntaxin-1A STX2 pro-1146 Recombinant Human Syntaxin-2 STX3 pro-1082 Recombinant Human Syntaxin-3 STX4 pro-1176 Recombinant Human Syntaxin-4 SUB1 pro-835 Recombinant Human SUB1 Homolog SUFU pro-938 Recombinant Human Suppressor of Fused Homolog SUGT1 pro-096 Recombinant Human SGT1 SUMF1 pro-986 Recombinant Human Sulfatase Modifying Factor 1 SUMO1 pro-326 Recombinant Human Small Ubiquitin-Related Modifier 1 SUMO1 His pro-980 Recombinant Human Small Ubiquitin-Related Modifier 1, His Tag SUMO2 pro-586 Recombinant Human Small Ubiquitin-Related Modifier 2 SUMO2 GST pro-541 Recombinant Human Small Ubiquitin-Related Modifier 2, GST SUMO3 pro-267 Recombinant Human Small Ubiquitin-Related Modifier 3 SURF1 pro-764 Recombinant Human Surfeit-1 SYCE3 pro-1179 Recombinant Human Synaptonemal Complex Central Element Protein 3 SYF2 pro-969 Recombinant Human SYF2 RNA splicing factor SYT1 pro-239 Recombinant Human Synaptotagmin I SYT4 pro-1375 Recombinant Human Synaptotagmin IV TAC1 pro-1338 Recombinant Human Tachykinin-1 TAC3 pro-716 Recombinant Human Tachykinin-3 TACSTD2 pro-157 Recombinant Human Tumor-Associated Calcium Signal Transducer 2 TAGLN pro-851 Recombinant Human Transgelin TAGLN2 pro-124 Recombinant Human Transgelin-2 TAGLN3 pro-946 Recombinant Human Transgelin-3 TANK pro-1348 Recombinant Human TRAF Family Member-Associated NFKB Activator TARDBP pro-1410 Recombinant Human TAR DNA Binding Protein TAX1BP3 pro-981 Recombinant Human Tax1 Binding Protein 3 TBCA pro-705 Recombinant Human Tubulin Folding Cofactor A TBCB pro-1127 Recombinant Human Tubulin Folding Cofactor B TBCC pro-1180 Recombinant Human Tubulin Folding Cofactor C TBPL1 pro-736 Recombinant Human TBP-Like 1 TBCEL pro-030 Recombinant Human Tubulin Folding Cofactor E-Like TCEA1 pro-1098 Recombinant Human Transcription Elongation Factor A (SII)- 1 TCEAL1 pro-507 Recombinant Human Transcription Elongation Factor A (SII)-Like 1 TCEAL3 pro-1128 Recombinant Human Transcription Elongation Factor A (SII)-Like 3 TCEAL7 pro-1147 Recombinant Human Transcription Elongation Factor A (SII)-Like 7 TCEAL8 pro-1188 Recombinant Human Transcription Elongation Factor A (SII)-Like 8 TCEB1 pro-1017 Recombinant Human Transcription Elongation Factor B Polypeptide 1 TCEB2 pro-664 Recombinant Human Transcription Elongation Factor B Polypeptide 2 TCL1A pro-726 Recombinant Human T-cell Leukemia/Lymphoma 1A TCP1 pro-276 Recombinant Human T-Complex 1 TES pro-549 Recombinant Human Testis Derived Transcript TEV pro-585 Recombinant Tobacco Etch Virus Protease TFAM pro-095 Recombinant Human Transcription Factor-A TFB1M pro-903 Recombinant Human Transcription Factor B1, Mitochondrial TFB2M pro-1259 Recombinant Human Transcription Factor B2, Mitochondrial TFPI2 pro-860 Recombinant Human Tissue Factor Pathway Inhibitor 2 TGFBI pro-568 Recombinant Human Transforming Growth Factor Beta Induced TGFBI 182 pro-672 Recombinant Human Transforming Growth Factor Beta Induced 182 a.a. THAP1 pro-1089 Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1 THBS1 pro-288 Recombinant Human Thrombospondin Thrombin pro-339 Human Thrombin THYN1 pro-270 Recombinant Human Thymocyte Nuclear Protein 1 Thyroglobulin pro-443 Human Thyroglobulin TIAF1 pro-1211 Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1 TICAM2 pro-1036 Recombinant Human Toll-Like Receptor Adaptor Molecule 2 TIFA pro-1041 Recombiant Human TRAF-Interacting Protein with Forkhead-Associated Domain TIRAP pro-1181 Recombinant Human Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein TMOD3 pro-1165 Recombinant Human Tropomodulin 3 TNIP1 pro-005 Recombinant Human TNFAIP3 Interacting Protein 1 TNNI1 pro-1269 Recombinant Human Troponin I Type 1 TNNI2 pro-1283 Recombinant Human Troponin I Type 2 TNNT2 pro-703 Recombinant Human Troponin T Type 2, Cardiac Isoform 3 TOLLIP pro-228 Recombinant Human Toll Interacting Protein TPD52L1 pro-442 Recombinant Human Tumor Protein D52 L1 TPM1 pro-469 Recombinant Human Tropomyosin-1 TPM2 pro-069 Recombinant Human Tropomyosin-2 TPM3 pro-1020 Recombinant Human Tropomyosin-3 TPM4 pro-187 Recombinant Human Tropomyosin-4 TPRKB pro-1185 Recombinant Human TP53RK Binding Protein TPT1 pro-776 Recombinant Human Tumor Protein Translationally-Controlled 1 TRAF1 pro-834 Recombinant Human TNF receptor-Associated Factor 1 TRAF2 pro-685 Recombinant Human TNF receptor-Associated Factor 2 Transferrin pro-747 Recombinant Human Transferrin TRAPPC2 pro-1272 Recombinant Human Trafficking Protein Particle Complex 2 TRAPPC3 pro-1056 Recombinant Human Trafficking Protein Particle Complex 3 TRAPPC4 pro-1273 Recombinant Human Trafficking Protein Particle Complex 4 TREM1 pro-457 Recombinant Human Triggering Receptor Expressed on Myeloid Cells 1 TRIM21 pro-328 Recombinant Human Tripartite Motif Containing 21 (RO52) Troponin 1 pro-341 Recombinant Human fast skeletal Troponin 1 Troponin I-C pro-344 Recombinant Human Cardiac Troponin I-C Complex Troponin I-C pro-345 Recombinant Single Chain Cardiac Troponin I-C Troponin I-C pro-346 Recombinant Single Chain Cardiac Troponin I-C 2nd generation Troponin-C pro-322 Recombinant Human Cardiac Troponin-C Troponin-C His pro-959 Recombinant Human Cardiac Troponin-C His Troponin-I pro-324 Recombinant Human Cardiac Troponin-I Troponin-T pro-342 Human Cardiac Troponin-T TROVE2 pro-329 Recombinant Human TROVE Domain Family Member 2 TROVE2 His pro-110 Recombinant Human TROVE Domain Family Member 2 His Tag Trypsin pro-770 Recombinant Human Trypsin Trypsin Yeast pro-786 Recombinant Human Trypsin, Yeast TSC22D3 pro-1254 Recombinant Human TSC22 Domain Family, Member 3 TSEN15 pro-144 Recombinant Human tRNA Splicing Endonuclease 15 TSG101 pro-805 Recombinant Human Tumor Susceptibility Gene 101 TSN pro-271 Recombinant Human Translin TSNAX pro-1292 Recombinant Human Translin-Associated Factor X TSSC4 pro-1021 Recombinant Human Tumor Suppressing Subtransferable Candidate 4 TTC1 pro-1160 Recombinant Human Tetratricopeptide Repeat Domain 1 TTC32 pro-1246 Recombinant Human Tetratricopeptide Repeat Domain 32 TTC33 pro-1217 Recombinant Human Tetratricopeptide Repeat Domain 33 TUBB3 pro-1388 Recombinant Human Tubulin, Beta 3 Class III TUBG1 pro-982 Recombinant Human Tubulin Gamma 1 TULP1 pro-1191 Recombinant Human Tubby Like Protein 1 TWF1 pro-1003 Recombinant Human Twinfilin-1 TXN1 pro-334 Recombinant E.Coli Thioredoxin TXN1 pro-569 Recombinant Human Thioredoxin TXN1, His pro-784 Recombinant E.Coli Thioredoxin, His TXN1, His pro-804 Recombinant Human Thioredoxin His Tag TXN2 pro-625 Recombinant Human Thioredoxin-2 TXNDC12 pro-1133 Recombinant Human Thioredoxin Domain Containing 12 TXNDC17 pro-1055 Recombinant Human Thioredoxin Domain Containing 17 TXNL1 pro-084 Recombinant Human Thioredoxin-Like 1 TXNL4A pro-1100 Recombinant Human Thioredoxin-Like 4A TXNL4B pro-238 Recombinant Human Thioredoxin-Like 4B TYW5 pro-1315 Recombinant Human tRNA-yW Synthesizing Protein 5 U. Urealyticum pro-670 Recombinant Ureaplasma Urealyticum Parvum UBD pro-927 Recombinant Human Ubiquitin-D Ubiquitin pro-314 Recombinant Human Ubiquitin Ubiquitin Biotin pro-629 Recombinant Human Ubiquitin Biotin Ubiquitin G76A pro-280 Recombinant Human Ubiquitin Gly76 to Ala76 mutation Ubiquitin GST pro-735 Recombinant Human Ubiquitin, GST Tag Ubiquitin K48R pro-372 Recombinant Human Ubiquitin Lys 48 to Arg 48 mutation UBL3 pro-230 Recombinant Human Ubiquitin-Like 3 UBL4A pro-1043 Recombinant Human Ubiquitin-Like 4A UBL5 pro-231 Recombinant Human Ubiquitin-Like 5 UBTD2 pro-1203 Recombinant Human Ubiquitin Domain Containing 2 UFM1 pro-125 Recombinant Human Ubiquitin-Fold Modifier 1 UFSP1 pro-1320 Recombinant Human UFM1-Specific Peptidase 1 ULBP2 pro-1134 Recombinant Human UL16 Binding Protein 2 Ulinastatin pro-608 Recombinant Human Urinary Trypsin Inhibitor (UTI) Ulinastatin pro-321 Human Urinary Trypsin Inhibitor (UTI) UNC119B pro-1034 Recombinant Human UNC-119 Homolog B UPK2 pro-479 Recombinant Human Uroplakin 2 UPK3A pro-988 Recombinant Human Uroplakin 3A UQCRC2 pro-1224 Recombinant Human Ubiquinol-Cytochrome C Reductase Core Protein II URM1 pro-188 Recombinant Human Ubiquitin Related Modifier 1 USH1C pro-706 Recombinant Human Usher Syndrome 1C USP14 pro-016 Recombinant Human Ubiquitin Specific Peptidase 14 UTP23 pro-1235 Recombinant Human UTP23, Small Subunit Processome Component UXT pro-1312 Recombinant Human Ubiquitously-Expressed, Prefoldin-Like Chaperone VAMP1 pro-577 Recombinant Human Synaptobrevin-1 VAMP2 pro-578 Recombinant Human Synaptobrevin-2 VAMP3 pro-652 Recombinant Human Synaptobrevin-3 VAMP4 pro-714 Recombinant Human Vesicle-Associated Membrane Protein 4 VAMP5 pro-681 Recombinant Human Synaptobrevin-5 VAMP7 pro-1194 Recombinant Human Vesicle-Associated Membrane Protein 7 VAMP8 pro-660 Recombinant Human Synaptobrevin-8 VAPA pro-779 Recombinant Human VAMP Associated Protein A, 33kDa VAPB pro-014 Recombinant Human VAMP Associated Protein B and C VASP pro-191 Recombinant Human Vasodilator-Stimulated Phosphoprotein VAT1 pro-1011 Recombinant Human Vesicle Amine Transport Protein 1 Homolog VBP1 pro-1325 Recombinant Human Von Hippel-Lindau Binding Protein 1 VCAM1 pro-386 Recombinant Human Vascular cell adhesion molecule 1 VDR pro-205 Recombinant Human Vitamin D Receptor VHL pro-440 Recombinant Human Von Hippel-Lindau Protein Vimentin pro-309 Recombinant Human Vimentin Vimentin GST pro-734 Recombinant Human Vimentin, GST Tag VOPP1 pro-200 Recombinant Human Vesicular Overexpressed in Cancer, Prosurvival Protein 1 VPS24 pro-872 Recombinant Human Vacuolar Protein Sorting 24 VPS25 pro-1054 Recombinant Human Vacuolar Protein Sorting 25 VPS26A pro-1161 Recombinant Human Vacuolar Protein Sorting 26A VPS28 pro-730 Recombinant Human Vacuolar Protein Sorting 28 VPS29 pro-1075 Recombinant Human Vacuolar Protein Sorting 29 mVPS29 pro-1066 Recombinant Mouse Vacuolar Protein Sorting 29 VRK3 pro-1130 Recombinant Human Vaccinia Related Kinase 3 VSNL1 pro-723 Recombinant Human Visinin-Like Protein-1 VSNL1 His pro-602 Recombinant Human Visinin-Like Protein-1 His Tag VSTM2L pro-1018 Recombinant Human V-Set and Transmembrane Domain Containing 2 Like VTA1 pro-1044 Recombinant Human Vps20-Associated 1 Homolog VTI1B pro-1115 Recombinant Human Vesicle Transport Through Interaction with t-SNAREs Homolog 1B WBP2 pro-1208 Recombinant Human WW Domain Binding Protein 2 WDR5 pro-863 Recombinant Human WD Repeat Domain 5 WHSC2 pro-062 Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2 WIBG pro-864 Recombinant Human within BCGN Homolog WIF1 pro-684 Recombinant Human WNT Inhibitory Factor 1 WLS pro-1402 Recombinant Human Wntless XAGE1A pro-1256 Recombinant Human X Antigen Family, Member 1A XG pro-1395 Recombinant Human XG Blood Group XPA pro-026 Recombinant Human Xeroderma Pigmentosum, Complementation Group A YEATS4 pro-1019 Recombinant Human YEATS Domain Containing 4 yTXN1 pro-333 Recombinant Yeast Thioredoxin 重慶市華雅干細胞技術有限公司 ： |
設為主頁
加入收藏
聯系我們
點擊放大
